Genuine Diamond Snowflake Earrings for Christmas

Regular price £1,000.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Refined Winter-Inspired Design

The Genuine Diamond Snowflake Earrings for Christmas are designed for those who appreciate seasonal symbolism with timeless appeal. Inspired by the delicate structure of a snowflake, this design captures symmetry and light in a balanced, wearable form. While ideal for festive occasions, the elegant motif allows these earrings to transition beyond the holiday season.

Structured Detailing with Visual Lightness

The snowflake silhouette is carefully structured to maintain proportion and clarity. Each diamond is positioned to enhance brilliance without overwhelming the design, creating a refined sparkle from multiple angles. The arrangement prioritizes symmetry and clean lines, offering a composed and polished finish.

Natural Diamond Craftsmanship

Natural diamonds are valued for their durability and enduring brilliance. Their hardness makes them suitable for earrings intended for repeated wear, particularly in designs that emphasize light reflection and fine detailing. When properly maintained, diamond jewelry retains its appearance over time.

High-Level Features

  • Snowflake-inspired diamond earring design.
  • Suitable for festive occasions and year-round styling.
  • Balanced structure for comfortable wear.
  • Complete specifications, including metal options and measurements, are provided in the product detail tables above.
Product Information
SKU SHP-EARRINGS032210249
Length 10.5 mm
Width 9 mm
Height 2.5 mm
Metal Weight 2.30 gm (Approximate)
Total Stone Weight 0.62 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 50 Pieces
Total Weight 0.62 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-12 Pcs
Round-1.30X1.30 mm-12 Pcs
Baguette-1X2 mm-12 Pcs
Round-0.80X0.80 mm-14 Pcs
Color HI
Cut Brilliant
Shape Round, Baguette
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Genuine Diamond Snowflake Earrings for Christmas

Are these earrings suitable for everyday wear?
Yes, diamonds are highly durable, and snowflake designs with secure settings can be worn regularly when handled with care.
Are these made with natural diamonds?
Yes, this design features genuine natural diamonds. For full specifications, please refer to the product detail tables above.
What metal options are available?
Available metal types and finishes are listed in the product detail tables above. Please review those sections for complete information.
Are these earrings appropriate as a Christmas gift?
Snowflake motifs are commonly chosen for holiday gifting due to their seasonal symbolism and elegant appearance.
Where can I find the exact dimensions and diamond details?
All verified specifications, including measurements and diamond details, are provided in the product detail tables above.