Genuine Emerald Vintage Inspired Eternity Band

Sale price £909.00 Regular price £999.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Emerald Wedding Band serves as a stunning representation of enduring love and commitment. Crafted with elegance, it showcases a round shape Emerald stones, arranged in a secure prong setting. The half eternity design strikes an ideal balance between daily comfort and timeless beauty. Emerald, the vibrant green gemstone, symbolizes rebirth, wisdom, and eternal youth. The band showcases a unique twisted rope design at the edges, which enhances depth and texture while representing two lives elegantly intertwined, allowing this Emerald Stackable Ring to shine with its distinctive and graceful appearance. This serves as a gentle reminder of unity and strength, making it ideal for the journey you are about to embark on or continue. It is an excellent choice as a wedding band, anniversary ring, or a thoughtful gift to commemorate significant milestones, as this Emerald Half Eternity Band narrates your love story with elegance and brilliance. The unbroken sequence of stones signifies everlasting love, serving as a sincere expression of forever. Meticulously crafted with attention to detail, this Wedding Anniversary Ring is offered in various metal types and colors, enabling you to customize it to reflect your personal style or to stack it with your cherished rings. Elegant yet modern, classic yet eye-catching, this Emerald Eternity Ring provides a touch of luxury and profound significance. A timeless piece for contemporary love stories.

Product Information
SKU SHP-RINGS0821258959
Width 1.5 mm
Height 4.5 mm
Metal Weight 3.12 gm (Approximate)
Total Stone Weight 0.23 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 13 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-13 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
men-ring