Genuine London Blue Topaz and Diamond Statement Ring with Beaded Details

Sale price £1,196.00 Regular price £1,343.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This exquisite Floral Engagement Ring represents a distinctive fusion of craftsmanship and brilliance, intended to elevate every occasion. At its core lies a stunning 7 MM round cut london blue topaz, securely fastened by a bezel setting. Encircling the central stone is a floral halo, artfully designed with small round diamond stones arranged to resemble delicate in a marquise shape metal design and beaded details. This design imparts the Cocktail Engagement Ring with a sophisticated yet striking character that exudes elegance and freshness. The overall appearance combines modern structure with floral delicacy, making it perfect for those who value exquisite design with a personal touch. Whether selected as an engagement ring or worn as a bold cocktail piece, this London Blue Topaz Engagement Ring effortlessly captures attention. The flower motif introduces a romantic essence, while the split band and meticulous stone arrangement provide a unique, contemporary flair. The AAA quality london blue topaz and HI-SI Diamond stone delivers exceptional brilliance and is recognized for its durability, rendering this Dinner Ring ideal for both daily wear and special events. It serves as a wonderful means to convey individuality and style through a piece that is both meaningful and beautifully crafted.

Product Information
SKU SHP-RINGS0821197671
Width 4.4 mm
Height 16.7 mm
Metal Weight 4.50 gm (Approximate)
Center Stone Weight 1.35 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 1 Pieces
Total Weight 1.35 Carat (Approximate)
Dimension(approx) Round-7X7 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Bezel Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.51 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-20 Pcs
Round-1.50X1.50 mm-10 Pcs
Round-1.60X1.60 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bezel Setting
Quality Grade SI
View More

Product Parent Collection Handle
london-blue-topaz-rings