Heart Key Pendant Necklace with Lab Grown Diamond

Sale price £996.00 Regular price £1,144.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Unlock a world of love and style with this Key Pendant Necklace with Heart Design. Crafted with a 5 MM Heart Shape Lab Grown Diamond gemstone set in 3 Prong Setting, this Pendant Necklace exudes elegance and sentiment. The heart motif speaks of affection and emotion, while the key represents the power to unlock hearts. Whether youre gifting it to a loved one or wearing it as a personal statement, our Simulated Diamond Pendant Necklace adds a touch of romance and individuality to any outfit.

Product Information
SKU SHP-PENDANT082310831
Metal Weight 4.50 gm (Approximate)
Total Stone Weight 0.52 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.52 Carat (Approximate)
Dimension(approx) Heart-5X5 mm-1 Pcs
Color White
Cut Brilliant
Shape Heart
Setting Type 3-Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
lab-grown-diamond-necklaces