Heart Shape Lab Grown Black and White Diamond Devil Jewelry Set

Regular price £1,316.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Celebrate love and sophistication with our Heart Jewelry Set, a beautifully coordinated Gothic Necklace and Earrings ensemble designed to make a statement. Each piece in the set features a stunning 8MM heart shaped black diamond, grown in a lab for ethical brilliance and enduring beauty. To add a touch of sparkle, a delicate lab grown white diamond is set at the tip of the tail, catching the light and enhancing the elegance of the design. Playful metal horns and tail give the Black Diamond Necklace Set a contemporary and whimsical flair, transforming a classic heart motif into a piece that is both fun and stylish. The pendant hangs gracefully from a durable cable chain, offering a versatile length for casual wear or special occasions, while the matching earrings feature secure screw-back closures, ensuring comfort and stability throughout the day. The cohesive design ensures the Devil Jewelry Set works beautifully together, whether worn as a complete ensemble or individually for a subtle pop of sophistication. Perfect for anniversaries, Valentine’s Day, birthdays, or simply to express love, this Black and White Diamond Jewelry Set combines elegance, charm, and meaningful symbolism.

Product Information
SKU SHP-PENDANT042167102
Metal Weight 5.39 gm (Approximate)
Total Stone Weight 7.24 Carat (Approximate)
SYNTHETIC BLACK DIAMOND INFORMATION
No.of Stones 3 Pieces
Total Weight 7.20 Carat (Approximate)
Dimension(approx) Heart-8X8 mm-3 Pcs
Color Black
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAAA ( Synthetic )
LAB GROWN DIAMOND INFORMATION
No.of Stones 3 Pieces
Total Weight 0.04 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-3 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
lab-created-black-diamond-necklace