Heart Shape Lab Grown Blue Sapphire and Diamond Tennis Bracelet

Regular price £2,640.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Bracelet Length
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Heart Shape Blue Sapphire Tennis Bracelet

This tennis bracelet features heart shape lab grown blue sapphires paired with diamonds in a continuous gemstone arrangement. The repeating sequence creates a balanced bracelet design that highlights the contrast between deep blue sapphires and bright diamonds.

The bracelet structure allows the gemstones to form a flowing line across the wrist, producing a refined piece of jewelry that combines vibrant gemstone color with classic bracelet styling.

Heart Shape Gemstone Design

Heart shaped gemstones introduce a distinctive silhouette that adds character to the bracelet while maintaining symmetry across the design. The shape softens the structure of the gemstone arrangement while keeping each stone clearly defined.

By repeating the heart motif throughout the bracelet, the design creates visual consistency while still allowing each gemstone to remain individually noticeable.

Blue Sapphire and Diamond Combination

Blue sapphires are valued for their rich color and clarity, making them a popular gemstone choice in fine jewelry. When paired with diamonds, the deep blue tone of the sapphires contrasts with the bright brilliance of the surrounding stones.

The sapphires used in this bracelet are lab grown, meaning they are created without traditional mining processes. Environmental impact may vary depending on production methods and energy sources.

Classic Tennis Bracelet Structure

Tennis bracelets are defined by a continuous row of gemstones linked together to form a flexible band. This design allows the bracelet to move naturally with the wrist while maintaining a uniform gemstone arrangement.

In this piece, the combination of heart shaped sapphires and diamonds forms a structured yet elegant bracelet style that highlights gemstone color and symmetry.

Product Information
SKU SHP-BRACELET042510009
Metal Weight 11.22 gm (Approximate)
Total Stone Weight 10.90 Carat (Approximate)
LAB CREATED BLUE SAPPHIRE INFORMATION
No.of Stones 23 Pieces
Total Weight 7.82 Carat (Approximate)
Dimension(approx) Heart-4X4 mm-23 Pcs
Color Blue
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 88 Pieces
Total Weight 3.08 Carat (Approximate)
Dimension(approx) Round-2X2 mm-88 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

FAQs About: Heart Shape Lab Grown Blue Sapphire and Diamond Tennis Bracelet

What is a tennis bracelet?
A tennis bracelet features a continuous row of gemstones linked together to form a flexible bracelet design.
What makes heart shaped gemstones distinctive?
Heart shaped gemstones feature a symmetrical shape with a curved top and pointed base, creating a distinctive and recognizable gemstone silhouette.
What is a lab grown blue sapphire?
A lab grown blue sapphire is created in controlled environments rather than mined from the earth, producing a gemstone with the same mineral composition as natural sapphire.
Why combine sapphires and diamonds in a bracelet?
Sapphires and diamonds are often paired in jewelry because the deep blue color of sapphires contrasts with the bright brilliance of diamonds.
Are tennis bracelets flexible?
Yes, tennis bracelets are designed with linked settings so the bracelet can move comfortably along the wrist.
What makes gemstone tennis bracelets popular?
Gemstone tennis bracelets are popular because they create a continuous line of stones that highlights color, symmetry, and brilliance.