IGI Certified 3 Carat Pink Heart Lab Grown Diamond Engagement Ring With Diamond

Sale price £1,475.00 Regular price £1,696.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Make the proposal unmistakably romantic with this IGI Certified 3 Carat Lab Grown Pink Diamond Heart Engagement Ring with Side Stones. A fancy pink heart-shaped lab grown diamond creates an expressive center, while round white lab grown diamonds add brilliance along the band without competing with its distinctive silhouette. With VS1 clarity at the center and a double-prong setting defining the heart shape, this pink diamond engagement ring brings together color, symbolism, and proposal-ready sparkle for a commitment that deserves a deeply personal focal point.

3 Carat Heart Shaped Lab Grown Pink Diamond Engagement Ring

The centerpiece is an approximately 3.00 carat lab grown pink diamond measuring about 9.00 x 9.50 mm. Its heart shape and brilliant cut emphasize the fancy pink color, while a double-prong setting secures the stone and preserves its romantic outline. Ten round brilliant lab grown white diamonds, each measuring approximately 2 x 2 mm, add another 0.35 carat along the band. The center diamond is graded Fancy Pink-VS1, while the side stones are graded E-F color and VS clarity. The confirmed metal in 92.5 sterling silver and selected yellow rose or white gold options in 10K, 14K, and 18K with an approximate metal weight of 2.40 grams.

What Makes This Pink Heart Diamond Engagement Ring Special

  • Approximately 3.00 carat heart-shaped lab grown pink diamond center stone.
  • Fancy Pink color and VS1 clarity center diamond.
  • Approximately 9.00 x 9.50 mm heart-shaped center with brilliant cut.
  • IGI certified lab grown pink diamond.
  • Ten round brilliant lab grown white diamond side stones.
  • Approximately 0.35 carat total weight in E-F VS accent diamonds.
  • Double-prong settings used for the center and side stones.
  • Approximately 3.35 carats of diamonds across the complete design.

The white side diamonds create bright contrast against the fancy pink center, helping the heart shape remain the defining feature while extending sparkle across the finger.

Meaning Behind a Pink Heart Diamond Engagement Ring

A heart-shaped diamond turns the symbolism of love into the actual silhouette of the center stone, making it especially fitting for an engagement or milestone commitment. The fancy pink color gives the design an even more individual character, while the white side diamonds frame the center with additional brilliance. For someone who wants a romantic alternative to a traditional colorless solitaire, this 3 carat pink diamond ring makes the proposal feel highly personal without relying on an overly elaborate setting.

IGI Certified Pink Lab Grown Diamond Craftsmanship & Authenticity

The 3 carat heart-shaped lab grown pink diamond engagement ring is IGI certified, providing independent grading information for the principal stone. Rosec Jewels crafts the ring with attention to heart-shape alignment, double-prong security, side-stone placement, and refined finishing. Rosec Jewels also offers a Certificate of Authenticity with its jewelry, while stone inspection, setting security review, and finishing inspection support quality control before dispatch. Care guidance helps preserve the diamonds and sterling silver finish with appropriate handling.

Pink Heart Diamond Engagement Ring Style & Wearability

From above, the approximately 9.00 x 9.50 mm heart-shaped center creates a bold pink focal point, while ten round white diamonds add balanced sparkle along both sides of the band. Its center-led profile makes it easy to wear as the primary engagement ring, with the heart motif providing instant romantic meaning. Available across a broad range of US ring sizes, it is well suited to proposals, anniversaries, milestone gifting, and brides who want a distinctive colored diamond ring. Choose your preferred ring size to make this IGI certified pink heart diamond ring part of your next chapter.

Product Information
SKU SHP-RINGS072610255
Metal Weight 2.40 gm (Approximate)
Center Stone Weight 3.00 Carat (Approximate)
LAB GROWN PINK DIAMOND(IGI) INFORMATION
No.of Stones 1 Pieces
Total Weight 3.00 Carat (Approximate)
Dimension(approx) Heart-9.00X9.50 mm-1 Pcs
Color Fancy Pink
Cut Brilliant
Shape Heart
Setting Type Double-Prong-Setting
Quality Grade VS1
LAB GROWN DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.35 Carat (Approximate)
Dimension(approx) Round-2X2 mm-10 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Double-Prong-Setting
Quality Grade VS
View More

FAQs About: IGI Certified 3 Carat Lab Grown Diamond Pink Heart Engagement Ring with Side Stones

What size and quality is the pink heart-shaped center diamond?

The center stone is an approximately 3.00 carat heart-shaped lab grown pink diamond measuring about 9.00 x 9.50 mm. It has a brilliant cut, Fancy Pink color, VS1 clarity, and is secured in a double-prong setting.

Is the 3 carat lab grown pink diamond IGI certified?

Yes. The approximately 3.00 carat Fancy Pink VS1 heart-shaped lab grown center diamond is IGI certified, providing independent grading information for the principal stone.

How many side diamonds are in this pink heart engagement ring?

The ring includes ten round brilliant lab grown white diamonds along the band. Each measures approximately 2 x 2 mm, and together they weigh about 0.35 carat. The side diamonds are graded E-F color and VS clarity.

What setting is used for the heart diamond and side stones?

The heart-shaped pink center diamond and round white side diamonds are secured in double-prong settings. The setting keeps the distinctive heart outline clearly visible while holding the accent stones along the band.

Why choose a pink heart-shaped diamond ring for an engagement?

The heart shape gives the center diamond an immediate connection to love and commitment, while the Fancy Pink color makes the design more distinctive than a traditional colorless center stone. White diamond side stones add contrast and make it especially suited to proposals, anniversaries, and romantic milestones.

What metal is confirmed for this 3 carat pink diamond engagement ring?

The confirmed metal in 92.5 sterling silver and selected yellow rose or white gold options in 10K, 14K, and 18K. The ring has an approximate metal weight of 2.40 grams and is available across a broad selection of US ring sizes.

How should I care for a lab grown pink diamond engagement ring?

Clean the ring gently with mild soap, lukewarm water, and a soft brush or cloth, then rinse and dry it carefully. Avoid harsh chemicals, abrasive contact, and strong impacts, store the ring separately when it is not being worn, and periodically check the double-prong settings to help keep the center and side diamonds secure.