IGI Certified 4 Carat Emerald Cut Lab Grown Diamond Solitaire Engagement Ring with Bow

Regular price £1,231.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Looking for a ring that is simple but still turns heads? This Emerald Cut Diamond Engagement Ring is all about quiet charm with a bold twist. This Lab Grown Diamond Ring featuring a Bow will unite hearts in love. Crafted with careful attention, this ring showcases an IGI Certified 4 Carat Emerald Cut Lab Grown Diamond in a prong setting. To enhance its sparkle, the bow is designed with hallmarked metal on both side of center stone and features Round brilliant cut Diamonds in bezel setting. This gorgeous 4 Carat Diamond Engagement Ring perfectly merges classic elegance with contemporary design. Created by Rosec Jewels, this Emerald Cut Ring is the perfect gift for her on a memorable day. The charming bow motif represents the strong connection you share, wrapping your love story in a design that is both playful and deeply elegant. This Huge Engagement Ring is a bright celebration of your union, destined to be a jewelry piece that shines with the promise of a beautiful future together. As the ultimate example of classic beauty, this Bow Ring radiates charm and is a must-have for your collection. Celebrated for its elegance and style, it offers a modern classic look for daily wear or special occasions. Taking the spotlight, this Lab Created Diamond Ring is incredibly adaptable with a modern yet timeless twist on a traditional design.

Product Information
SKU SHP-RINGS062610281
Metal Weight 2.96 gm (Approximate)
Center Stone Weight 4.00 Carat (Approximate)
LAB GROWN DIAMOND(IGI) INFORMATION
No.of Stones 1 Pieces
Total Weight 4.00 Carat (Approximate)
Dimension(approx) Emerald Cut-11.00X7.50 mm-1 Pcs
Color E
Cut Brilliant
Shape Emerald Cut
Setting Type Prong-Setting
Quality Grade VS1
LAB GROWN DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.03 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-2 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More