Lab Created Ruby Flower Drop Hoop Earrings with Diamond

Regular price £1,077.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Romantic color meets graceful movement in these lab created ruby flower drop hoop earrings, designed for the woman who loves jewelry with softness, sparkle, and meaning. A blooming floral drop brings rich red ruby brilliance below a diamond-lined hoop, creating a design that feels expressive without being overly ornate. Whether chosen for an anniversary, birthday, July birthstone gift, wedding celebration, or a personal milestone, these earrings carry the warmth of love and the charm of nature-inspired style.

Lab Created Ruby Flower Drop Hoop Earrings With Diamond Accent

Crafted as flower drop hoop earrings, this pair combines round brilliant cut lab created rubies with round brilliant cut diamond accents in prong settings. The floral ruby cluster forms the focal point, while the diamond-studded hoop adds a refined shimmer from the ear down to the drop. Available in 10K, 14K, and 18K white or yellow gold, the design offers a polished fine-jewelry look with the flexibility to suit different metal preferences.

What Makes This Special

The earrings feature 14 round lab created rubies with a total ruby weight of approximately 2.03 carats. Each ruby measures approximately 3 x 3 mm and is arranged in a flower-inspired cluster, giving the drop a full, petal-like presence.

A total of 24 round diamonds, weighing approximately 0.24 carat, line the hoop with delicate sparkle. The diamonds are HI color and SI quality grade, adding contrast and brightness around the rich red ruby centerpiece.

The prong setting allows the stones to remain visually open while keeping the floral layout defined. A secure hinged hoop back supports comfortable wear, making the earrings easy to put on and suited for extended occasions.

The pair measures approximately 22 mm in length, 8.7 mm in width, and 12 mm in height, with an approximate weight of 3.68 grams. The proportions create noticeable movement while keeping the design wearable and balanced.

Why Choose This Design

Ruby brings a passionate red color that naturally draws attention, while the flower drop silhouette softens the look with feminine detail. The round brilliant cut helps both the rubies and diamonds reflect light with lively sparkle, giving the earrings depth from the front and a graceful glow as they move.

The hoop-and-drop construction makes this pair more dimensional than classic studs, yet easier to style than long statement earrings. The hinged hoop back adds security and convenience, while the choice of white or yellow gold across 10K, 14K, and 18K options lets the design feel either crisp and modern or warm and romantic.

Design Meaning

The floral motif gives these lab ruby earrings a sense of blooming affection, growth, and celebration. Ruby is often associated with love, passion, and heartfelt devotion, making the design especially meaningful for anniversaries, romantic gifts, and milestone moments. The diamonds along the hoop add a touch of light around the ruby flower, creating a symbolic balance of warmth and radiance.

Authenticity & Craftsmanship

Rosec Jewels crafts this pair with careful attention to stone placement, setting security, and refined finishing. Each earring goes through stone inspection, setting security review, and finishing inspection before dispatch, helping ensure the ruby flower drops and diamond-accented hoops meet quality expectations. A Certificate of Authenticity is offered with the earrings for added confidence. For lasting care, store the earrings separately, avoid harsh chemicals, and clean them gently with a soft jewelry cloth after wear.

Style and Wearability

These ruby and diamond hoop earrings bring color close to the face while the flower drops add a graceful finishing touch below the lobe. They pair beautifully with cocktail dresses, wedding guest looks, evening outfits, and polished daywear. Worn with a ruby pendant or a slim diamond bracelet, they create a coordinated fine-jewelry look; worn alone, they offer enough detail to feel special without overwhelming the outfit.

Product Information
SKU SHP-EARRINGS022012360
Length 22 mm
Width 8.7 mm
Height 12 mm
Weight 3.68 gm (Approximate)
Center Stone Weight 2.03 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 14 Pieces
Total Weight 2.03 Carat (Approximate)
Dimension(approx) Round-3X3 mm-14 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 24 Pieces
Total Weight 0.24 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-24 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-ruby-earrings

FAQs About: Lab Created Ruby Flower Drop Hoop Earrings with Diamond

What makes these ruby flower drop hoop earrings a meaningful gift?

The floral ruby drop gives the earrings a romantic, nature-inspired meaning, while ruby’s rich red color is associated with love and passion. This makes them a thoughtful choice for anniversaries, birthdays, July birthstone gifts, weddings, and personal celebrations.

What stones are used in these earrings?

These earrings feature 14 round lab created rubies with a total weight of approximately 2.03 carats and 24 round diamonds with a total weight of approximately 0.24 carat. The rubies are AAAA quality grade, and the diamonds are HI color with SI quality grade.

What cut and setting style do the earrings have?

The lab created rubies and diamonds are round brilliant cut stones. Both stone types are secured in prong settings, allowing the ruby flower cluster and diamond hoop accents to catch light while keeping the design refined and defined.

Which metal options are available for this design?

This design is available in 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, giving buyers the option to choose a cooler white metal look or a warmer yellow gold finish.

Are these earrings comfortable and secure to wear?

Yes. The earrings are designed with a secure hinged hoop back for ease of wear and a comfortable fit. Their approximate 22 mm length gives them visible drop movement while keeping the silhouette practical for events, dinners, celebrations, and dressed-up everyday styling.

Do these ruby and diamond earrings come with authenticity support?

Rosec Jewels offers a Certificate of Authenticity with the jewelry. Each pair also goes through stone inspection, setting security review, and finishing inspection before dispatch for added purchase confidence.

How should I care for these lab created ruby earrings?

Store the earrings separately in a jewelry box or pouch to help prevent scratches. Avoid harsh chemicals, perfumes, and abrasive cleaners, and wipe them gently with a soft jewelry cloth after wear to maintain the shine of the metal, rubies, and diamonds.