Lab Grown Diamond and Ruby Flower Cocktail Ring with Certificate

Sale price £699.00 Regular price £803.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Enhance your collection with a touch of elegance through this Flower Cocktail Ring, crafted to capture attention with its floral-inspired allure. Curated with a dazzling EF-VS Quality 4 MM Round Shape Lab Grown Diamond, elegantly set in claw setting, encircled by Bezel Set Marquise Cut Lab Grown Ruby stones that create delicate petals, forming a delightful flower motif. This Diamond Flower Ring is an exquisite option for special events and can also serve as a distinctive engagement ring. Its striking design infuses a hint of glamour without overwhelming, making this Flower Engagement Ring ideal for both daily wear and festive occasions. Each diamond and ruby is lab grown, providing an eco-conscious and budget friendly alternative to conventional gemstones while still radiating ample sparkle. The design strikes a balance between femininity and modernity, making this Diamond and Ruby Ring a considerate gift or a lovely addition to your own collection. Offered in a complete range of US standard sizes from 3 to 13, this Statement Ring for Women guarantees a snug fit for every hand. The ring is thoughtfully packaged in a jewelry box.

Product Information
SKU SHP-RINGS042610004
Metal Weight 3.00 gm (Approximate)
Total Stone Weight 1.55 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade EF-VS
LAB CREATED RUBY INFORMATION
No.of Stones 10 Pieces
Total Weight 1.30 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-10 Pcs
Color Red
Cut Brilliant
Shape Marquise
Setting Type Claw-Set
Quality Grade AAAA
View More