Lab Grown Diamond Antique Looking Engagement Ring

Sale price £1,265.00 Regular price £1,454.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Lab Grown Diamond Engagement Ring is truly one-of-a-kind and captivating, inspired by the beauty of nature and featuring a stunning sparkle. It showcases an 8 MM round cut lab grown diamond set in double prong as a Solitaire, with floral engravings on the shank and beaded detailing that adds extra elegance. The floral engravings, sparkling with delicate diamonds, create a unique shine and a nature-inspired theme that blends perfectly. This Vintage Style Engagement Ring symbolizes beauty, curated to be admired. The flower motif beneath the main stone is embellished with peek-a-boo diamond, enhancing the overall sparkle without drawing attention away from the dazzling solitaire. As a token of love with endless options, this Solitaire Diamond Engagement Ring is both pretty and delicate, capturing all the memories of your special day. Show off a floral vibe with this stunning 2 Carat Diamond Ring featuring EF-VS Quality lab diamonds, which she will adore as a symbol of commitment and eternity. It is designed for brides seeking a unique piece that embodies romance while also reflecting a touch of old-world charm and the beauty of nature. This Flower Engagement Ring is a timeless expression of love. Celebrate your love with this exquisite piece and let her treasure it forever.

Product Information
SKU SHP-RINGS052410185
Width 6.5 mm
Height 8 mm
Metal Weight 4.78 gm (Approximate)
Center Stone Weight 2.04 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 2.12 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-8 Pcs
Round-8X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Double-Prong-Setting
Quality Grade EF-VS
View More