Lab Grown Diamond Cocktail Necklace For Women

Sale price £1,218.00 Regular price £1,400.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

The Lab Grown Diamond Floral Necklace represents a timeless and elegant addition to any jewelry collection, radiating a sense of feminine allure. Its exquisite flower motif is designed to attract attention and admiration. The Cocktail Necklace features a breathtaking array of various gemstones, resulting in a captivating visual display. At its heart lies an 8 MM Round Shape Lab Grown Diamond, securely held in prong setting. Additionally, the Halo Necklace is adorned with small round Lab Grown Ruby, Diamond, and Oval Shape Lab Grown Emerald stones with vintage-inspired designs that make a bold statement. This sophisticated Floral Inspired Diamond Pendant embodies the beauty of nature and is a perfect expression of your affection. You can have confidence in the quality of our offerings, as each piece is accompanied by a certificate of authenticity.

Product Information
SKU SHP-PENDANT022510039
Metal Weight 4.50 gm (Approximate)
Total Stone Weight 3.56 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 2.22 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Round-1.50X1.50 mm-5 Pcs
Round-1.30X1.30 mm-10 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
LAB CREATED RUBY INFORMATION
No.of Stones 5 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Round-2X2 mm-5 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
LAB CREATED EMERALD INFORMATION
No.of Stones 5 Pieces
Total Weight 1.10 Carat (Approximate)
Dimension(approx) Oval-3X4 mm-5 Pcs
Color Green
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAAA
View More