Lab Grown Diamond Flower Hoop Earrings For Her

Regular price £1,207.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Let your style blossom with these Diamond Drop Earrings, designed to add a touch of natures grace to your jewelry collection. These beauties feature a radiant 6 MM round cut lab grown diamond of EF-VS Quality set in prong setting, surrounded by a floral motif. The intertwined curves of the flower are adorned with smaller diamonds that enhance the overall shimmer. These Flower Dangle Earrings are handcrafted with a secure and comfortable lever back closure, they stay in place allowing you to move with confidence. These Nature Inspired Diamond Earrings are a versatile addition to your jewelry collection, perfect for a wedding, cocktail party, or any grand celebration - wear them and watch every eye in the room turn to you.

Product Information
SKU SHP-EARRINGS022510027
Metal Weight 4.00 gm (Approximate)
Total Stone Weight 2.37 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 42 Pieces
Total Weight 2.37 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-40 Pcs
Round-6X6 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More