Lab Grown Diamond Infinity Love Knot Necklace For Women

Sale price £729.00 Regular price £838.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Show your everlasting love in a truly special way with an elegant Diamond Infinity Necklace. This stunning piece features petite round diamonds set in prongs, beautifully highlighting the infinity-inspired design. At the center, a cluster of Marquise Shape Lab Made Diamonds creates a lovely leaf motif, adding visual charm and extra sparkle. Whether for a special occasion or simply to show you care, this Infinity Love Knot Necklace makes a romantic gift that’s perfect for any day. It’s also a fabulous choice for your mom, wife, or girlfriend, as this dazzling jewelry piece can be worn as an everyday sparkle to express your heartfelt affection.

Product Information
SKU SHP-PENDANT022510049
Metal Weight 3.00 gm (Approximate)
Total Stone Weight 0.43 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 29 Pieces
Total Weight 0.43 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-8 Pcs
Round-1.10X1.10 mm-1 Pcs
Round-1.20X1.20 mm-4 Pcs
Round-1.30X1.30 mm-16 Pcs
Color White
Cut Brilliant
Shape Marquise, Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More