Lab Grown Diamond Paw Print Earrings For Women

Sale price £627.00 Regular price £721.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful Design for Animal Lovers

These lab grown diamond paw print earrings are created for women who want their jewelry to carry personal meaning. The paw motif represents companionship, loyalty, and connection, making this design especially suited for pet lovers and sentimental gifting.

The earrings are lightweight and thoughtfully proportioned, allowing them to be worn comfortably throughout the day without feeling intrusive or overstated.

Paw Print Design with Subtle Diamond Accents

The paw print form is kept clean and refined, avoiding excessive detailing so the design remains timeless rather than novelty-focused. Diamonds are placed to highlight the shape without overpowering it.

This balance allows the earrings to pair easily with both casual and polished outfits.

Lab Grown Diamonds for Everyday Jewelry

Lab grown diamonds are chosen for their consistency and suitability for regular wear. They are created without traditional mining, though environmental impact varies by production process and energy source.

With proper care, lab grown diamonds retain their appearance and structural integrity over time.

High-Level Features

  • Paw print inspired earring design
  • Lab grown diamond accents
  • Lightweight and comfortable for daily wear
  • Meaningful style suited for gifting
Product Information
SKU SHP-EARRINGS062510053
Length 10.5 mm
Width 10.8 mm
Metal Weight 2.40 gm (Approximate)
Total Stone Weight 0.40 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 84 Pieces
Total Weight 0.40 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-2 Pcs
Round-1.10X1.10 mm-12 Pcs
Round-1X1 mm-32 Pcs
Round-0.90X0.90 mm-38 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

FAQs: Lab Grown Diamond Paw Print Earrings

What does the paw print design symbolize?

Paw print jewelry is often associated with companionship, loyalty, and a lasting bond with pets.

Are these earrings suitable for everyday wear?

The earrings are designed to be lightweight and comfortable, making them suitable for regular daily use with appropriate care.

What are lab grown diamonds?

Lab grown diamonds are created in controlled environments and share the same physical properties as mined diamonds.

Are these earrings a good gift option?

The sentimental design makes them a thoughtful gift, particularly for pet lovers or meaningful occasions.

How should these earrings be cared for?

Gentle cleaning and careful storage help maintain the earrings’ finish and appearance over time.