Lab Grown Diamond Star Circle Necklace With Decorated Bail

Sale price £871.00 Regular price £1,001.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Shine like the star you are with this breathtaking Diamond Celestial Necklace, it is not just a piece of jewelry but a statement of brilliance. This Designer Pendant features an open circle frame and a shooting star motif adorned with sparkling round cut diamonds (lab grown) set in secure prong setting. The unique hidden bail detailing enhances the beauty of this Diamond Star Necklace. Comes with a certificate of authenticity, this Diamond Necklace for Women sits perfectly on the neckline, offering both comfort and elegance. Whether worn as a symbol of aspiration or gifted as a meaningful token, this Star and Moon Necklace is a timeless treasure that speaks of dreams, sparkle, and refined luxury.

Product Information
SKU SHP-PENDANT022510069
Metal Weight 4.00 gm (Approximate)
Total Stone Weight 0.52 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 34 Pieces
Total Weight 0.52 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-2 Pcs
Round-0.90X0.90 mm-3 Pcs
Round-1.10X1.10 mm-6 Pcs
Round-1.20X1.20 mm-4 Pcs
Round-1.40X1.40 mm-3 Pcs
Round-1.50X1.50 mm-1 Pcs
Round-1.60X1.60 mm-3 Pcs
Round-1.70X1.70 mm-6 Pcs
Round-1.90X1.90 mm-6 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More