Lab Grown Diamond Toi Et Moi Promise Ring with Infinity Knot

Regular price £993.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbol of Two Becoming One

This lab grown diamond Toi Et Moi promise ring with infinity knot design represents connection, balance, and enduring commitment. The Toi Et Moi setting—meaning “you and me”—places two diamonds side by side, celebrating partnership and shared journeys.

Designed as a meaningful promise ring, it offers a refined expression of devotion with a modern, sculptural touch.

Toi Et Moi with Infinity Knot Detail

The dual-stone arrangement creates visual harmony, while the infinity knot motif adds symbolic depth. The flowing lines of the knot reflect continuity and unity, seamlessly integrating into the band for a cohesive look.

This combination of structure and symbolism makes the design distinctive without feeling ornate or overwhelming.

Lab Grown Diamond Brilliance

Lab grown diamonds share the same physical and optical properties as mined diamonds, making them suitable for everyday ring wear. They are created without traditional mining, though environmental impact varies by production and energy source.

The result is a brilliant, durable gemstone choice that supports thoughtful purchasing decisions.

High-Level Features

This promise ring features a two-stone Toi Et Moi layout enhanced by an infinity knot-inspired band. The design emphasizes symbolic meaning, balanced proportions, and secure stone placement for confident daily wear.

Product Information
SKU SHP-RINGS022210377
Width 3.6 mm
Height 7.1 mm
Metal Weight 3.70 gm (Approximate)
Center Stone Weight 0.76 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.76 Carat (Approximate)
Dimension(approx) Pear-4X6 mm-2 Pcs
Color E-F
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade VS
View More

Product Parent Collection Handle
toi-et-moi-rings

FAQs About: Lab Grown Diamond Toi Et Moi Promise Ring With Infinity Knot

What does a Toi Et Moi promise ring symbolize?
A Toi Et Moi design represents two individuals united in a shared commitment, making it a meaningful choice for a promise ring.
How does the infinity knot enhance the ring’s meaning?
The infinity knot symbolizes continuity and lasting connection, reinforcing the message of enduring commitment.
Is a lab grown diamond suitable for daily promise ring wear?
Yes, lab grown diamonds have the same hardness as natural diamonds, making them durable for everyday wear when properly set.
Does a two-stone ring feel balanced on the finger?
When designed with proportional alignment and secure settings, a two-stone layout maintains visual and physical balance for comfortable wear.
How should I care for this Toi Et Moi promise ring?
Clean gently with mild soap and lukewarm water, rinse thoroughly, and dry with a soft cloth to maintain brilliance and shine.