Lab Pave Set Diamond Sideways Infinity Butterfly Necklace

Sale price £674.00 Regular price £774.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

They say beauty lies in the details, and this Diamond Infinity Necklace is proof that elegance and meaning can blend effortlessly into one perfect design. Handcrafted in top notch metal, the infinity symbol is adorned with a shimmering row of lab grown diamond, adding a luxurious sparkle to the timeless design. A delicate butterfly motif sits at one side of the infinity loop, symbolizing new beginnings and the beauty of change. This Diamond Necklace is a classic and designer piece of jewelry perfect for any occasion. Whether you wear it as a daily reminder of infinite possibilities or gift it to someone special, this Infinity Butterfly Necklace is designed to shine as bright as the moments it represents.

Product Information
SKU SHP-PENDANT022510063
Metal Weight 2.80 gm (Approximate)
Total Stone Weight 0.20 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 33 Pieces
Total Weight 0.20 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-33 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade EF-VS
View More