London Blue Topaz Floral Engagement Ring For Women

Regular price £583.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral Expression of Commitment

The London Blue Topaz Floral Engagement Ring for Women is designed for those who want a proposal ring that feels romantic yet distinctive. The deep blue tone of London blue topaz offers a bold alternative to traditional center stones, while the floral-inspired detailing introduces softness and symbolism. This ring suits someone who values individuality and meaningful design in fine jewelry.

Floral-Inspired Setting with Balanced Structure

The floral motif frames the center stone with carefully arranged detailing, creating dimension and visual movement. The setting is crafted to support the gemstone securely while maintaining an elegant and wearable profile. For complete information regarding stone size, metal options, and technical specifications, please refer to the product detail tables above.

London Blue Topaz Characteristics

London blue topaz is known for its deep, saturated blue color and refined brilliance. As a natural gemstone, it benefits from mindful daily wear and proper care to help maintain its surface and appearance over time. Its rich tone pairs well with intricate metalwork, making it a distinctive choice for an engagement ring.

High-Level Features

  • London blue topaz center stone.
  • Floral-inspired engagement ring design.
  • Structured setting crafted for balance and visual appeal.
  • Full technical specifications available in the product detail tables above.
Product Information
SKU SHP-RINGS0821183560
Width 3.5 mm
Height 8 mm
Metal Weight 1.84 gm (Approximate)
Total Stone Weight 1.25 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 7 Pieces
Total Weight 1.25 Carat (Approximate)
Dimension(approx) Round-3X3 mm-7 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
london-blue-topaz-rings