Marquise Cut Created Blue Sapphire and Moissanite Flower Half Eternity Ring

Regular price £672.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral Design with Distinctive Structure

The Marquise Cut Created Blue Sapphire and Moissanite Flower Half Eternity Ring is designed for those who appreciate nature-inspired details with a refined finish. The marquise-cut stones form a delicate floral pattern, offering a unique visual rhythm across the band.

Its structured yet graceful appearance makes it suitable for both everyday wear and meaningful occasions.

Flower Motif with Half Eternity Layout

The floral arrangement is created using marquise-cut stones, carefully placed to mimic petal-like forms. This design introduces both symmetry and movement, giving the ring a distinctive identity.

The half eternity style ensures that the decorative elements remain visible while maintaining comfort and practicality for regular wear.

Created Blue Sapphire and Moissanite Pairing

Created blue sapphires are valued for their consistent color and clarity, offering a uniform appearance. They are created without traditional mining, though their impact varies by production and energy source.

Moissanite accents contribute additional brilliance, enhancing the overall contrast between deep color and light reflection.

High-Level Features Buyers Appreciate

The ring is designed to provide a comfortable fit with a balanced band structure. Its floral detailing allows it to stand out as a statement piece while still pairing well with other rings.

The combination of structured design, vibrant color, and subtle sparkle makes it versatile for both daily styling and special occasions.

Product Information
SKU SHP-RINGS032224900
Weight 1.84 gm (Approximate)
LAB CREATED BLUE SAPPHIRE INFORMATION
No.of Stones 12 Pieces
Total Weight 0.36 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-12 Pcs
Color Blue
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade AAAA
MOISSANITE INFORMATION
No.of Stones 4 Pieces
Total Weight 0.49 Carat (Approximate)
Dimension(approx) Baguette-2X4 mm-4 Pcs
Color White
Cut Brilliant
Shape Baguette
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
stone-shape-swatches

FAQs About: Marquise Cut Created Blue Sapphire and Moissanite Flower Half Eternity Ring

Is this ring suitable for everyday wear?
Yes, the half eternity design makes it comfortable for regular wear while maintaining its decorative appearance.
What is a half eternity ring?
A half eternity ring features stones set along the top portion of the band, offering visual impact while improving comfort and wearability.
What makes the floral design unique?
The floral pattern is formed using marquise-cut stones arranged like petals, creating a structured yet natural-inspired look.
How do moissanite accents enhance the ring?
Moissanite adds brightness and contrast, enhancing the overall sparkle without overshadowing the sapphire stones.
Can this ring be stacked with other bands?
Yes, its design allows it to be paired with other rings for a layered or coordinated look.
Who is this ring ideal for?
It is ideal for those who prefer nature-inspired designs with a balance of color, structure, and detail.