Marquise Diamond Lotus Cartilage Drop Earring

Regular price £460.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Refined Lotus Design for Cartilage Styling

The marquise diamond lotus cartilage drop earring is designed for curated ear styling with a distinct yet balanced presence. Its lotus-inspired silhouette introduces symbolic elegance while maintaining proportion suitable for cartilage placement.

This piece is ideal for helix or upper ear piercings where detail matters and scale must remain controlled.

Architectural Drop with Structured Placement

The lotus motif is formed using marquise diamonds arranged to create layered structure. A subtle drop element adds movement while keeping the design aligned close to the ear for stability.

The setting is crafted to balance decorative expression with secure wear, ensuring the earring maintains its orientation throughout the day.

Light Behavior: Directional Edge Brilliance

Marquise-cut diamonds reflect light with directional edge brilliance, emphasizing the pointed tips and elongated curves. The open structure of the lotus form allows light to pass through, creating defined sparkle without excessive shimmer.

Diamond Value and Everyday Consideration

Diamonds are valued for their durability and ability to maintain brilliance over time. When worn with proper care, they are suitable for daily styling, especially in secure cartilage placements.

Product Information
SKU SHP-BODYJ052310067
Length 11 mm
Width 10 mm
Height 2.3 mm
Metal Weight 0.90 gm (Approximate)
Total Stone Weight 0.67 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 4 Pieces
Total Weight 0.67 Carat (Approximate)
Dimension(approx) Marquise-3X6 mm-1 Pcs
Marquise-2.50X5.00 mm-2 Pcs
Round-2.20X2.20 mm-1 Pcs
Color HI
Cut Brilliant
Shape Marquise, Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Marquise Diamond Lotus Cartilage Drop Earring

Is this earring sold as a single piece?
Cartilage earrings are typically sold as single pieces unless otherwise specified in the product details.
Is it suitable for helix piercing?
Yes, this design is suitable for helix and upper cartilage piercings when the gauge and length match your piercing.
Will the drop element move while wearing?
The drop adds subtle movement while remaining structured enough to stay aligned with the ear.
Can this be paired with other cartilage studs?
Yes, it pairs well with minimal studs or small hoops to create a layered ear styling look.
How should I clean this cartilage earring?
Clean gently with mild soap and warm water using a soft brush, then dry thoroughly before wearing.