Marquise Lab Grown Ruby Leaf Bolo Bracelet

Sale price £1,101.00 Regular price £1,266.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Add a touch of elegance and charm to any outfit with this stunning Ruby Bolo Bracelet. Designed to capture the beauty of nature, the piece features clusters of marquise shaped lab created ruby stones arranged gracefully to form delicate leaf patterns. Each gemstone is set securely in prong setting, allowing them to catch the light beautifully and create a sparkling effect. The adjustable bolo clasp makes this Leaf Bracelet versatile and easy to wear, ensuring a comfortable fit for all wrist sizes. Whether worn alone as a statement piece or paired with other jewelry for a layered look, this Nature Inspired Bracelet enhances any style effortlessly. Perfect as a gift, the Leaf Bolo Bracelet is ideal for birthdays, anniversaries, Valentine’s Day, or just to show someone you care. Its vibrant ruby hues symbolize love, passion, and vitality, while the leaf motif adds a sense of natural beauty and elegance. Carefully crafted with attention to detail, it combines style, sparkle, and versatility in one beautiful piece.

Product Information
SKU SHP-BRACELET022012339
Length 178 mm
Width 2 mm
Metal Weight 6.44 gm (Approximate)
Total Stone Weight 6.24 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 48 Pieces
Total Weight 6.24 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-48 Pcs
Color Red
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade AAAA
View More

Product Parent Collection Handle
bolo-bracelets