Minimal Diamond Snowflake Earrings with Screw Back

Regular price £600.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Minimal Snowflake Diamond Earrings

These minimal diamond snowflake earrings are designed for buyers who prefer refined, understated jewelry with a meaningful motif. The snowflake-inspired design offers a balanced blend of symmetry and delicacy, making these earrings suitable for daily wear as well as thoughtful gifting.

Crafted with a focus on comfort and proportion, this pair is ideal for those seeking subtle sparkle without visual heaviness. The design is intentionally minimal to allow versatility across casual and formal settings.

Design & Screw Back Setting

The snowflake form is structured to maintain clarity of shape while supporting the diamonds securely. The screw back closure is selected for added stability, helping the earrings stay comfortably in place during extended wear.

Diamond Use & Wearability

Diamonds are widely used in fine jewelry due to their suitability for regular wear. When properly set and maintained, they provide lasting visual appeal for everyday earrings.

High-Level Features

  • Minimal snowflake-inspired diamond design
  • Screw back closure for secure, comfortable wear
  • Lightweight structure for daily use
  • Balanced proportions for subtle elegance
Product Information
SKU SHP-EARRINGS032151641
Metal Weight 2.00 gm (Approximate)
Total Stone Weight 0.18 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-2.40X2.40 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade SI
View More
Are these earrings suitable for everyday wear?
Yes, the minimal design and secure screw back closure make them suitable for regular, everyday use when cared for properly.
What is the benefit of a screw back closure?
Screw back closures provide added security and are often chosen for comfort during extended wear.
Are these earrings lightweight?
The design is intended to remain lightweight while maintaining structural balance, supporting comfortable daily wear.
What metal options are available?
Available metal options and specifications are listed in the product detail tables on this page.
How should these earrings be maintained?
Gentle cleaning and proper storage help preserve the appearance and longevity of diamond earrings.