Moissanite Crescent Moon Helix Earring for Women

Sale price £346.00 Regular price £397.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Celestial Design with Contemporary Appeal

The Moissanite Crescent Moon Helix Earring is designed for those who prefer subtle symbolism combined with modern styling. Inspired by the crescent moon, it offers a distinctive look that complements curated ear arrangements.

Its refined form makes it suitable for both minimal styling and layered ear jewelry combinations.

Helix Placement and Functional Design

Created specifically for helix piercings, this earring is shaped to follow the natural curve of the ear. The design ensures a close fit that enhances both comfort and stability when worn.

Its compact structure allows it to integrate seamlessly with other earrings without overpowering the overall look.

Moissanite Stone Value

Moissanite is known for its brilliance and light performance, offering a bright and reflective appearance. It is created without traditional mining, though impact varies by production and energy source.

With proper care, moissanite is suitable for regular wear while maintaining its visual clarity.

High-Level Features Buyers Appreciate

The crescent moon motif adds a symbolic element, while the helix-specific design ensures a secure and balanced fit. Its lightweight structure makes it easy to wear throughout the day.

It works well as a standalone piece or as part of a curated ear stack for a layered aesthetic.

Product Information
SKU SHP-BODYJ0921397614
Length 7 mm
Width 5 mm
Height 2 mm
Weight 0.90 gm (Approximate)
Center Stone Weight 0.14 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 5 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-2 Pcs
Round-1.80X1.80 mm-2 Pcs
Round-2X2 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
helix-earrings

FAQs About: Moissanite Crescent Moon Helix Earring for Women

What is a helix earring?
A helix earring is designed specifically for the upper cartilage of the ear, known as the helix.
Is this earring suitable for everyday wear?
Yes, with proper care, it can be worn regularly due to its lightweight and secure design.
Does it stay secure in the helix piercing?
The design is crafted to follow the ear’s natural curve, helping it sit securely when properly fitted.
Can it be paired with other earrings?
Yes, it is ideal for layering with other earrings to create a curated ear look.
Is moissanite a durable stone?
Moissanite is known for its durability and can maintain its appearance with proper care.
Who is this earring ideal for?
It is ideal for those who want a subtle yet distinctive piece for helix piercings with a modern and symbolic design.