Moissanite Princess Cut Engagement Ring With Celtic Knot Design

Regular price £819.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Princess Cut Moissanite Celtic Knot Engagement Ring

This engagement ring combines a princess cut moissanite center stone with an intricate Celtic knot band, bringing together brilliance and meaningful design. The structured geometry of the princess cut contrasts beautifully with the flowing knot motif, creating a ring that balances modern elegance with symbolic craftsmanship.

Its distinctive design makes it appealing to those who appreciate engagement rings that express both personal symbolism and refined visual detail.

Celtic Knot Band Design

The Celtic knot pattern has long been recognized as a symbol of eternity and interconnectedness. Its continuous lines represent an unbroken bond, making it a meaningful element in engagement jewelry.

In ring design, this motif creates a visually intricate band structure that adds depth and character while complementing the central gemstone.

Princess Cut Moissanite Center Stone

The princess cut is known for its square shape and sharp faceting pattern, designed to reflect light effectively across the surface of the stone. This cut delivers a modern and symmetrical appearance that works well with contemporary ring designs.

Moissanite is appreciated for its strong brilliance and durability, making it a practical choice for engagement jewelry intended for regular wear.

Design Balance and Visual Appeal

The contrast between the precise princess cut stone and the flowing Celtic knot band creates a balanced composition. The center stone draws attention through its geometric brilliance, while the band introduces artistic detailing.

This thoughtful design combination results in a ring that feels distinctive without appearing overly ornate.

Product Information
SKU SHP-RINGS0821330372
Width 5.5 mm
Height 9.5 mm
Metal Weight 2.90 gm (Approximate)
Center Stone Weight 3.15 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 3.15 Carat (Approximate)
Dimension(approx) Princess Cut-8X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Princess Cut
Setting Type Prong-Setting
Quality Grade D-VS1
View More

FAQs About: Moissanite Princess Cut Engagement Ring With Celtic Knot Design

What does a Celtic knot engagement ring symbolize?
Celtic knot designs traditionally symbolize eternity, unity, and interconnectedness because the pattern has no beginning or end.
What is a princess cut moissanite?
A princess cut moissanite features a square shape with multiple facets designed to maximize brilliance and create a modern geometric appearance.
Is moissanite suitable for engagement rings?
Moissanite is commonly used in engagement rings because it offers strong brilliance and durability suitable for everyday wear.
Why choose a princess cut engagement ring?
Princess cut engagement rings are popular for their modern square shape and brilliant faceting that reflects light effectively.
What makes Celtic engagement rings unique?
Celtic engagement rings are distinctive because of their symbolic knot patterns, which add artistic detail and cultural meaning to the ring design.
Can a Celtic knot ring be worn every day?
Celtic knot engagement rings are typically designed for regular wear, combining decorative band patterns with durable center stones.