Natural 0.6 Carat Ruby Flower Engagement Ring with Diamond Bypass Shank

0
Regular price £1,076.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bloom into a love story that is as vibrant as this Flower Engagement Ring, where every detail mirrors the beauty of a growing bond. At the center, a 5mm Round Shape Ruby set in Prong Setting blossoms in a rose flower motif, symbolizing passion, devotion and the start of something beautifully alive. The floral design carries a deeper meaning, it grows, evolves, and becomes more enchanting with time. Flowing around it, the Bypass Shank adorned with Diamond stones gently curves, representing two souls on unique paths coming together in perfect harmony. This Ruby Diamond Engagement Ring wraps the finger with a graceful sparkle, catching the light from every angle while maintaining an elegant, modern charm. This Bypass Engagement Ring stands as a promise of nurturing love, shared dreams and a journey that continues to blossom. Perfect as an marriage ring or a heartfelt expression of commitment, this Ruby Engagement Ring arrives in a signature jewelry box and is available in multiple ring sizes to match your preference. A piece designed to shine and to tell a story of love that grows stronger with every passing day.

Product Information
SKU SHP-RINGS062016162
Width 5 mm
Height 11.5 mm
Metal Weight 3.22 gm (Approximate)
Center Stone Weight 0.65 Carat (Approximate)
RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-14 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.40X1.40 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
ruby-engagement-rings