Natural 1.2 Carat Emerald Cut Emerald Diamond Engagement Ring with Celtic Knot

Sale price £1,052.00 Regular price £1,156.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Embrace the magic of forever with this Emerald Cut Engagement Ring. This stunning piece is a celebration of love that transcends time, featuring a 5X7 mm Emerald Cut Emerald in Prong Setting at its heart, a stone that symbolizes growth and enduring strength. Flanking the AAA Quality Emerald are two intricately designed Trinity knots, each one a symbol of unity and eternal connection, creating a perfect balance of beauty and meaning. The slim band, adorned with sparkling HI-SI Diamond stones, adds a touch of modern elegance, ensuring the focus remains on the vibrant emerald and the timeless Celtic motif. Designed to honor your unique love story, this Emerald Diamond Ring for Engagement creates a captivating contrast that catches the light with every movement. Whether you are beginning a lifetime together or reaffirming a love that already feels endless, this Celtic Knot Engagement Ring is the perfect emblem of your commitment. Presented in a signature jewelry box and available in various sizes, this Solitaire Engagement Ring with Emerald is ready to be cherished for a lifetime.

Product Information
SKU SHP-RINGS032210191
Width 7 mm
Height 3.5 mm
Metal Weight 2.00 gm (Approximate)
Center Stone Weight 1.21 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 1.21 Carat (Approximate)
Dimension(approx) Emerald Cut-5X7 mm-1 Pcs
Color Green
Cut Brilliant
Shape Emerald Cut
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 12 Pieces
Total Weight 0.12 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-12 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
emerald-engagement-rings