Natural Amethyst Diamond Heart Drop Earrings

Sale price £768.00 Regular price £862.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Present these Heart Drop Earrings as a sparkling testament to love, elegance and timeless beauty. Each earring features a 5 mm Round Shape Amethyst placed in an open heart frame, delicately lined with dazzling Diamond stones that catch the light with every movement. Dangling gracefully from a heart motif, these Amethyst Drop Earrings create a romantic cascade of shimmer, perfectly capturing the essence of affection and devotion. The rich purple hue of the Amethyst symbolizes passion and wisdom, while the sparkling Diamond stones add a touch of celestial brilliance, making these Amethyst Heart Earrings a captivating statement for any occasion. Crafted with a secure Screw Back Closure, they offer comfort without compromising style, allowing her to wear them all day or night with confidence. Beautifully presented in a signature jewelry box, these Amethyst Earrings for Women make an unforgettable gift for anniversaries, birthdays or simply as a heartfelt surprise. Romantic, sophisticated and endlessly versatile, these Amethyst Diamond Earrings are a celebration of love and a timeless treasure designed to make her heart flutter every time they catch the light.

Product Information
SKU SHP-EARRINGS052174804
Length 17 mm
Width 9.4 mm
Metal Weight 2.44 gm (Approximate)
Total Stone Weight 1.08 Carat (Approximate)
AMETHYST INFORMATION
No.of Stones 2 Pieces
Total Weight 0.90 Carat (Approximate)
Dimension(approx) Round-5X5 mm-2 Pcs
Color Violet
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 30 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-2 Pcs
Round-1X1 mm-28 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
amethyst-earrings