Natural Blue Sapphire Star Pendant Necklace for Women

Sale price £868.00 Regular price £954.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Simple yet full of charm, this Star Pendant Necklace is designed to shine in the sweetest way. The Star Motif holds a stunning 4 mm Round Shape Blue Sapphire set in Prong Setting at its center, glowing with a rich, dreamy blue hue that instantly catches the light. This Blue Sapphire Pendant Necklace is the kind of piece that is easy to wear every single day. Whether styled with a casual dress for a night out, this Real Sapphire Pendant adds just the right hint of sparkle without being too bold. It sits beautifully along the neckline, making it perfect for layering or wearing on its own as a subtle statement. Presented in a signature jewelry box, this September Birthstone Necklace is ready to gift for birthdays, graduations, holidays or any moment worth celebrating. Stylish and meaningful, this Womens Blue Sapphire Necklace is a reminder to shine bright and follow your own path wherever life takes you.

Product Information
SKU SHP-PENDANT042170132
Length 18.7 mm
Width 12.6 mm
Metal Weight 3.60 gm (Approximate)
Total Stone Weight 0.40 Carat (Approximate)
BLUE SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.40 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
blue-sapphire-necklaces