Natural Citrine Flower Engagement Ring with Diamond

Regular price £744.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This natural citrine flower engagement ring with diamond accents offers a vibrant alternative to traditional engagement styles. The warm golden hue of citrine becomes the focal point, while the floral-inspired arrangement creates a romantic and distinctive silhouette.

Floral Design & Setting

Designed to echo the form of a blooming flower, the setting frames the citrine in a petal-like composition. Diamond accents enhance the overall brilliance, adding light and contrast around the center stone. The balanced structure allows the floral motif to feel refined rather than ornate, making it suitable for meaningful everyday wear.

About Natural Citrine & Diamonds

Natural citrine is appreciated for its bright, sunlit color and clarity. As a gemstone used in fine jewelry, it brings warmth and individuality to engagement designs. Diamonds are valued for their durability and sparkle, offering structural strength and added brilliance to complement the citrine centerpiece.

Key Highlights

  • Natural citrine center: warm golden tone with lively presence.
  • Flower-inspired setting: petal-like arrangement for a romantic look.
  • Diamond accents: refined sparkle and visual contrast.
  • Distinctive style: blends color and symbolic floral detail.
Product Information
SKU SHP-RINGS0821190913
Width 5.6 mm
Height 7.5 mm
Metal Weight 2.30 gm (Approximate)
Center Stone Weight 0.51 Carat (Approximate)
CITRINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.51 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Yellow
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 24 Pieces
Total Weight 0.12 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-12 Pcs
Round-1X1 mm-12 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
citrine-rings

FAQs About: Natural Citrine Flower Engagement Ring with Diamond

Is citrine suitable for an engagement ring?
Citrine is valued for its bright color and clarity. With secure settings and proper care, it can be chosen for engagement rings that highlight individuality.
What does a flower engagement ring symbolize?
Floral designs are often associated with growth, beauty, and new beginnings, making them meaningful choices for engagement jewelry.
Can this ring be worn daily?
With mindful care and regular maintenance, this ring can be worn regularly. Gentle handling helps preserve the gemstone and overall setting.
Can it be paired with a wedding band?
Yes, pairing options depend on the band’s contour and desired style. Many choose a complementary band that aligns with the floral silhouette.
Are natural gemstones unique?
Natural gemstones can display slight variations in tone and internal characteristics, giving each piece a distinct appearance.