Natural Emerald and Diamond Leaf Wrap Ring

Regular price £1,325.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


An Organic Silhouette Inspired by Nature

This natural emerald and diamond leaf wrap ring captures the fluid movement of botanical forms. The wrap-style design curves gently around the finger, creating a layered look that feels sculptural yet refined.

Its leaf-inspired detailing makes it a thoughtful choice for those drawn to nature motifs paired with fine gemstone accents.

Leaf Wrap Design and Setting Detail

The wrap structure allows the ring to contour naturally, with leaf elements framing the center composition. This creates dimension and visual flow while maintaining balance across the band.

Diamond accents add brightness along the curves, highlighting the organic lines without overpowering the emerald centerpiece.

Natural Emerald with Diamond Accents

Natural emerald is admired for its rich green hue and distinctive internal character. Its vibrant tone provides a striking contrast against the brilliance of diamonds.

The combination of emerald and diamond brings together bold color and classic sparkle within a nature-inspired setting.

High-Level Features

This ring features a natural emerald complemented by diamond accents in a leaf wrap design. The overall look emphasizes flowing structure, gemstone contrast, and a graceful, organic profile suited for meaningful occasions or distinctive everyday wear.

Product Information
SKU SHP-RINGS0821196409
Width 2.5 mm
Height 16 mm
Metal Weight 3.75 gm (Approximate)
Total Stone Weight 2.14 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 12 Pieces
Total Weight 1.80 Carat (Approximate)
Dimension(approx) Marquise-2.50X5.00 mm-4 Pcs
Marquise-2X4 mm-8 Pcs
Color Green
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 17 Pieces
Total Weight 0.34 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-1 Pcs
Round-1.40X1.40 mm-6 Pcs
Round-1.50X1.50 mm-10 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
cocktail-rings

FAQs About: Emerald and Diamond Leaf Wrap Ring

What is a leaf wrap ring design?
A leaf wrap ring features an open or curved band that encircles the finger with botanical-inspired elements, creating a flowing and organic silhouette.
How do emerald and diamond work together in this design?
The deep green tone of emerald contrasts with the brightness of diamonds, enhancing both color richness and overall brilliance within the wrap setting.
Is a wrap-style ring comfortable for daily wear?
Wrap-style rings are designed to follow the natural curve of the finger. Proper sizing helps ensure a secure and comfortable fit for regular wear.
What occasions suit a leaf-inspired emerald ring?
Its organic motif and gemstone contrast make it suitable for engagements, anniversaries, or as a distinctive statement piece.
How should an emerald and diamond ring be cared for?
Gentle cleaning with mild soap and water, along with careful storage away from impact, helps preserve both the emerald and diamond accents.