Natural Emerald Taurus Zodiac Constellation Necklace with Diamond

Sale price £1,776.00 Regular price £1,951.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This zodiac constellation necklace highlights the Taurus star pattern with a natural emerald and diamond accents arranged within the design. The constellation layout creates a symbolic representation of the Taurus sign while incorporating gemstones that add color and brilliance to the pendant.

The necklace blends celestial inspiration with gemstone craftsmanship, allowing the constellation motif to remain the central visual focus.

Taurus Constellation Design

Constellation jewelry represents star formations associated with zodiac signs. In this pendant, the Taurus constellation is illustrated through carefully positioned stones that reflect the recognizable star pattern.

The design creates a subtle connection between astronomy and personal symbolism, making the necklace meaningful for those who identify with the Taurus sign.

Natural Emerald Accent

Emerald is a gemstone recognized for its rich green color and long-standing presence in fine jewelry. When incorporated into constellation jewelry, it adds a distinctive color highlight to the design.

The emerald accent complements the surrounding stones while emphasizing the celestial motif of the pendant.

Diamond Constellation Details

Diamond accents are placed within the constellation layout to create points of brightness that represent the star pattern. Their reflective qualities enhance the visual clarity of the constellation design.

The combination of emerald and diamond provides a contrast between vibrant color and luminous sparkle.

Symbolic Zodiac Jewelry

Zodiac necklaces are often chosen for their personal significance and distinctive design elements. By representing the Taurus constellation through gemstones, the pendant merges symbolic meaning with decorative craftsmanship.

The design allows the necklace to function both as a meaningful zodiac piece and as a refined gemstone pendant.

Product Information
SKU SHP-PENDANT042210258
Metal Weight 7.00 gm (Approximate)
Total Stone Weight 0.89 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 13 Pieces
Total Weight 0.39 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-10 Pcs
Round-2X2 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
taurus-zodiac-sign-jewelry

FAQs About: Natural Emerald Taurus Zodiac Constellation Necklace with Diamond

What does a Taurus constellation necklace represent?
A Taurus constellation necklace represents the star pattern associated with the Taurus zodiac sign and is often worn as a symbol of personal identity.
Why are gemstones used in constellation jewelry?
Gemstones are placed to represent stars within a constellation pattern while also adding brilliance and color to the jewelry design.
What makes emerald distinctive?
Emerald is known for its deep green color and has been widely used in fine jewelry for its distinctive appearance.
Why combine emerald and diamonds in jewelry?
Diamonds provide brightness and contrast that highlights the color of emerald gemstones within the design.
Are zodiac necklaces worn daily?
Many zodiac necklaces are designed for everyday wear because their symbolic design and compact size make them versatile accessories.
What occasions are zodiac necklaces suitable for?
Zodiac necklaces are often chosen as meaningful gifts for birthdays or personal milestones related to a zodiac sign.