Natural Freshwater Pearl Flower Pendant and Earrings with Diamond

0
Regular price £1,228.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

If you have a tendency for all things bright and flowery, this jewelry set will not disappoint. It comes with an elegant necklace pendant and a matching pair of earrings that emulate the beauty of a blossom. Studded with a round freshwater pearl, petal motif, and round Diamond, this bridal set is reminiscent of happy times. The additional bead detailing adds a bit of traditional beauty to this minimal jewelry. The jewelry set is highly customizable with an array of metal options to choose from.

Product Information
SKU SHP-PENDANT042172995
Metal Weight 4.00 gm (Approximate)
Total Stone Weight 12.38 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 3 Pieces
Total Weight 12.00 Carat (Approximate)
Dimension(approx) Round-10X10 mm-1 Pcs
Round-5X5 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 12 Pieces
Total Weight 0.38 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-8 Pcs
Round-2.30X2.30 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
freshwater-pearl-necklaces