Natural Garnet and Diamond Flower Stud Earrings

Sale price £730.00 Regular price £821.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the beauty of nature, the Garnet Stud Earrings capture the essence of elegance and timeless charm. Designed with intricate craftsmanship, the design features round cut garnet at its center, surrounded by dazzling diamond stones that form a radiant floral pattern. Crafted from high quality materials, these Flower Stud Earrings are made to endure while maintaining their refined beauty for years to come. The vivid hue of the AAA quality garnet symbolizes love, passion, and vitality, while the surrounding HI-SI quality diamonds add brilliance and light. The floral motif reflects nature’s grace and femininity, making the design both delicate and striking. The classic stud style ensures comfort and versatility, allowing these Garnet and Diamond Earrings to complement both casual and formal ensembles effortlessly. Secure screw back closures provide a snug and reliable fit, offering ease and confidence for daily wear or special occasions. Perfect as a thoughtful gift for someone who appreciates fine craftsmanship and unique design, the Garnet Floral Earrings add a touch of sophistication to any jewelry collection.

Product Information
SKU SHP-EARRINGS0621113501
Length 10.7 mm
Width 10.7 mm
Height 3.5 mm
Metal Weight 1.22 gm (Approximate)
Total Stone Weight 1.24 Carat (Approximate)
GARNET INFORMATION
No.of Stones 2 Pieces
Total Weight 0.68 Carat (Approximate)
Dimension(approx) Round-4X4 mm-2 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.56 Carat (Approximate)
Dimension(approx) Round-1.80X1.80 mm-16 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
garnet-earrings