Natural Peridot Leaf Earrings with Diamond for Women

Sale price £487.00 Regular price £547.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the beauty of nature, these Peridot Stud Earrings bring a fresh and graceful touch to your jewelry collection. Designed with a leaf-like motif, each earring features a slanted 3X5 mm Pear Shaped Peridot that glows with a soft green sparkle. The gentle curve of the design, paired with shimmering Diamond stones, creates a look that feels elegant yet lively. The secure Screw Back Closure ensures a comfortable fit, making them perfect for daily wear or special moments. Whether you are heading to a brunch, a festive event or simply dressing up your everyday outfit, these Peridot Diamond Earrings add a natural charm that complements every style. Packed in a signature jewelry box, these Peridot Earrings for Women also make a thoughtful gift for birthdays, anniversaries or meaningful celebrations. If you love designs that feel fresh, feminine and a little different, these Leaf Earrings are a beautiful way to express your style.

Product Information
SKU SHP-EARRINGS042157245
Length 11.3 mm
Width 5.5 mm
Metal Weight 1.60 gm (Approximate)
Total Stone Weight 0.50 Carat (Approximate)
PERIDOT INFORMATION
No.of Stones 2 Pieces
Total Weight 0.36 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-2 Pcs
Color Green
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 34 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-12 Pcs
Round-0.90X0.90 mm-22 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
peridot-earrings