Natural Ruby Open Heart Pendant Necklace for Women

Regular price £1,065.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Showcase timeless elegance and heartfelt meaning with this Ruby Heart Necklace, a beautiful accessory that combines simplicity with symbolic power. It features an open heart motif with three round cut ruby stones, carefully set in prong setting to highlight its radiant red color. Hanging gracefully from a delicate cable chain, the Red Ruby Necklace sits comfortably around the neck and can be paired effortlessly with both casual and formal outfits. Its simple yet striking design ensures it remains versatile, suitable for casual wear or for celebrating special moments such as anniversaries, birthdays, or romantic occasions. Crafted with care and precision, the Ruby Pendant Necklace blends durability with refined beauty, ensuring it will be treasured for years. Its heart shape represents love and affection, making it a thoughtful and symbolic gift. Whether given to a loved one or worn as a personal statement of strength and elegance, this Open Heart Necklace is a stunning way to add sparkle and meaning to any jewelry collection.

Product Information
SKU SHP-PENDANT052179806
Metal Weight 3.67 gm (Approximate)
Total Stone Weight 0.39 Carat (Approximate)
RUBY INFORMATION
No.of Stones 3 Pieces
Total Weight 0.39 Carat (Approximate)
Dimension(approx) Round-3X3 mm-3 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
ruby-necklace