Nature Inspired 0.6 Carat Ruby Diamond Engagement Ring for Women

0
Regular price £1,166.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Designed with a touch of the poetry of nature, this Flower Engagement Ring blooms with elegance and meaning. At its center lies a captivating 5 mm Round Shape Ruby, set within a flower motif that instantly draws the eye. The band flows like gentle vines, adorned with shimmering Diamond stones that add a soft sparkle from every angle. This Ruby Engagement Ring creates a graceful and enchanting look, almost like wearing a tiny blossom that never fades. This Nature Inspired Engagement Ring is often linked to growth, new beginnings and the beauty of a love that continues to flourish over time. The AAA Quality Ruby, known for its deep red glow, symbolizes passion and devotion, while the HI-SI Quality Diamond stones bring in a sense of strength and everlasting commitment. This Ruby and Diamond Engagement Ring carries the essence of a love that grows naturally and beautifully. Presented in a signature jewelry box and available in various ring sizes, this Ruby Flower Ring is ready to be chosen with care. Perfect as an engagement ring, a romantic proposal piece or a meaningful gift that celebrates a love rooted in nature and forever.

Product Information
SKU SHP-RINGS0821187977
Width 6 mm
Height 8 mm
Metal Weight 3.83 gm (Approximate)
Center Stone Weight 0.65 Carat (Approximate)
RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
ruby-engagement-rings