Nature Inspired Diamond Flower Earring for Tragus Piercing

Sale price £355.00 Regular price £408.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Softly inspired by a blooming flower, this diamond tragus earring brings a refined touch of nature to a curated ear. Five round diamonds come together in a petite floral silhouette, giving the piece a delicate sparkle that feels personal, polished, and expressive. Sold singly, it is a thoughtful choice for marking a new piercing, refreshing an ear stack, or gifting a subtle piece of diamond body jewelry for a special moment.

Natural Brilliant Cut Round Diamond Flower For Tragus Piercing

Designed as a floral diamond earring for tragus and other ear piercings, this piece features 5 round brilliant cut diamonds in a prong setting with an approximate total diamond weight of 0.35 carat. Its compact 7 mm by 7.3 mm profile and 2.5 mm height create a defined flower shape that adds sparkle without overwhelming the ear. Metal choices include 10K, 14K, and 18K yellow or white gold, with flat back post length options from 4.5 mm to 7.5 mm for a more personalized fit.

What Makes This Special

  • Nature-inspired flower design crafted for tragus, helix, cartilage, conch, and upper lobe piercings.
  • Set with 5 round diamonds, each measuring approximately 2.50 x 2.50 mm.
  • Approximate total diamond weight of 0.35 carat.
  • Round brilliant cut diamonds secured in a prong setting for visible sparkle and a clean floral outline.
  • Diamond details include HI color and SI quality grade.
  • Approximate dimensions: 7 mm length, 7.3 mm width, and 2.5 mm height.
  • Available with flat back post length options from 4.5 mm to 7.5 mm and left or right ear selection.
  • Sold as a single earring for customized ear styling.

Why Choose This Design

The round brilliant cut supports the flower motif beautifully because each diamond adds a soft point of light, creating the look of petals gathered around the center. The prong setting keeps the stones visually open while helping secure them in place, so the earring carries a bright, airy feel. Its small floral form makes it especially versatile for body jewelry styling, whether worn as the main sparkle in a tragus piercing or layered with other studs, hoops, and flat back earrings across a curated ear.

Design Meaning

A flower design naturally speaks to growth, renewal, affection, and quiet celebration. In this tragus earring, the floral shape gives the piece a softer emotional character than a classic single-stone stud, making it meaningful for birthdays, self-gifting, new beginnings, or a stylish reminder of someone special. The five-diamond bloom adds sentiment without feeling overly ornate, offering a graceful balance of symbolism and everyday wearability.

Authenticity & Craftsmanship

Rosec Jewels crafts this diamond flower earring with careful attention to proportion, stone placement, and finishing so the floral shape feels neat, secure, and refined. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch, with hand-checked precious metal quality supporting purchase confidence. Rosec Jewels also provides certified jewelry assurance with the jewelry, along with care guidance to help preserve the sparkle, setting, and finish over time.

Style and Wearability

Petite yet noticeable, this single diamond flower earring is designed to bring a bright accent to tragus styling while also working beautifully for helix, cartilage, conch, or upper lobe placements. The flat back post options help support a more tailored fit, and the choice of yellow or white gold in 10K, 14K, or 18K allows the piece to match existing jewelry tones. Wear it as a soft floral focal point or pair it with minimal studs and hoops for a layered ear stack with a polished diamond finish.

Product Information
SKU SHP-BODYJ082410074
Length 7 mm
Width 7.3 mm
Height 2.5 mm
Metal Weight 0.80 gm (Approximate)
Total Stone Weight 0.35 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.35 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-5 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Nature Inspired Diamond Flower Earring for Tragus Piercing

What makes this diamond flower earring a thoughtful gift?

Its floral design gives the earring a meaningful, nature-inspired feel, while the diamond sparkle makes it special enough for birthdays, piercing milestones, personal celebrations, or a stylish surprise for someone who loves curated ear jewelry.

What does the flower design symbolize?

The flower motif is often associated with growth, affection, renewal, and celebration. In this tragus earring, the five-diamond bloom adds a soft symbolic touch while keeping the overall look refined and wearable.

What diamonds are used in these flower earring?

This earring is set with 5 round diamonds in a brilliant cut, with an approximate total diamond weight of 0.35 carat. The diamonds measure approximately 2.50 x 2.50 mm each and are listed with HI color and SI quality grade.

What setting style is used for the diamonds?

The round diamonds are held in a prong setting. This setting style supports the floral layout while allowing the stones to remain visually open, helping the diamond arrangement create a bright petal-like effect.

Which metal options are available for this earring?

The earring is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold, giving buyers flexibility to match their existing ear stack or preferred jewelry tone.

Can this earring be worn in piercings other than the tragus?

Yes. This diamond floral earring can be styled in tragus, helix, cartilage, conch, or upper lobe piercings, making it a versatile choice for building a personalized ear stack.

How should I care for this diamond flower earring?

Store it separately when not in use, avoid harsh chemicals, and clean it gently with a soft cloth. Periodic checks of the prong setting are recommended to help maintain stone security and preserve the refined finish.