Oval Cut Peridot and Diamond Flower Engagement Ring with Certificate

Regular price £1,017.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the beauty of nature, this Flower Engagement Ring brings a romantic glow to your most treasured moments. At the center of this enchanting design is a 6X8 MM oval cut Peridot surrounded by marquise cut lab grown diamonds, expertly arranged to form a blooming flower that sparkles from every angle. The result is a ring that feels both fresh and timeless - perfect for those who value elegance with a whimsical flair. The floral motif lends this Peridot and Diamond Engagement Ring a graceful and feminine touch, capturing the essence of love in full bloom. Carefully crafted and designed to endure, this Peridot Engagement Ring merges classic style with playful beauty, ideal for women who appreciate fine jewelry that feels personal and expressive. Presented in a delightful jewelry box, it is ready to be gifted or cherished as a keepsake that symbolizes a love that continues to grow. Allow this Statement Flower Ring to be a lasting reminder that love, much like flowers, thrives with care and intention.

Product Information
SKU SHP-RINGS032221976
Metal Weight 2.88 gm (Approximate)
Center Stone Weight 1.10 Carat (Approximate)
PERIDOT INFORMATION
No.of Stones 1 Pieces
Total Weight 1.10 Carat (Approximate)
Dimension(approx) Oval-6X8 mm-1 Pcs
Color Green
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-8 Pcs
Color White
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
peridot-rings