Oval Moonstone Infinity Engagement Ring with Diamond

Sale price £693.00 Regular price £778.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Luminous Center with Symbolic Detail

The Oval Moonstone Infinity Engagement Ring with Diamond is designed for those drawn to soft light and meaningful form. At its center sits an oval moonstone, known for its natural glow and shifting play of light. The infinity-inspired setting frames the stone with gentle curves, symbolizing continuity and enduring connection.

This ring is suited for someone who values individuality over tradition, choosing a gemstone that feels personal and expressive.

Infinity Setting with Balanced Structure

The infinity motif is integrated into the shank, creating fluid lines that guide the eye toward the center stone. Diamond accents add refined brilliance while maintaining focus on the moonstone’s natural character.

The oval cut enhances surface area and elongates the appearance of the finger, offering a balanced and elegant profile. Confirmed stone specifications and measurements are detailed in the product tables below.

Moonstone and Diamond Combination

Moonstone is appreciated for its distinctive sheen, often described as a soft internal glow. As a gemstone traditionally associated with delicate beauty, it benefits from mindful wear. The surrounding diamonds introduce contrast and clarity, elevating the overall composition without overpowering the center.

Together, the gemstones create a ring that blends symbolism with refined craftsmanship.

High-Level Features

  • Oval moonstone center stone.
  • Infinity-inspired shank design.
  • Diamond accents for added brilliance.
  • Detailed specifications and verified materials listed in the product tables below.
Product Information
SKU SHP-RINGS0821214661
Width 7 mm
Height 8 mm
Metal Weight 2.60 gm (Approximate)
Center Stone Weight 0.60 Carat (Approximate)
MOONSTONE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.60 Carat (Approximate)
Dimension(approx) Oval-6X8 mm-1 Pcs
Color light blue
Cut Brilliant
Shape Oval
Setting Type Basket-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.12 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-4 Pcs
Round-0.90X0.90 mm-2 Pcs
Round-1.10X1.10 mm-8 Pcs
Round-1X1 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Basket-Setting
Quality Grade SI
View More

Product Parent Collection Handle
solitaire-engagement-rings

FAQs about: Oval Moonstone Infinity Engagement Ring with Diamond

Is moonstone suitable for an engagement ring?
Moonstone is chosen for its distinctive glow and symbolic appeal. As a softer gemstone compared to traditional diamonds, it benefits from mindful daily wear and proper care.
What does the infinity design represent?
The infinity motif symbolizes continuity and lasting connection, making it a meaningful detail for an engagement ring.
Are the side stones real diamonds?
The ring includes diamond accents as specified in the product details. All verified stone information is available in the product tables above.
Can this ring be paired with a wedding band?
Yes, this engagement ring can be paired with a compatible wedding band. The final fit will depend on the band style and ring size selected.
Where can I find the exact metal and stone specifications?
All confirmed details regarding metal options, gemstone specifications, and measurements are listed in the product detail tables above.