Pave Set Lab Grown Diamond Heart Bracelet for Women

Sale price £1,061.00 Regular price £1,220.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Pave Set Lab Grown Diamond Heart Bracelet for Women

This bracelet features a heart-shaped motif decorated with pavé-set lab grown diamonds, creating a design that emphasizes brilliance and delicate craftsmanship. The arrangement of small diamonds across the heart surface produces a continuous shimmer that draws attention to the centerpiece.

Designed with a balanced composition, the bracelet highlights the heart motif while maintaining a refined and graceful appearance on the wrist.

Heart Motif Design

Heart-shaped jewelry has long been associated with expressions of affection and meaningful symbolism. In this bracelet, the heart element forms the central visual focus while remaining integrated into the overall chain design.

The curved outline of the heart motif introduces a soft and elegant shape that complements the sparkle of the diamonds.

Pavé Diamond Setting

The pavé setting features numerous small diamonds positioned closely together across the surface of the heart motif. This technique creates the appearance of a continuous field of sparkle, enhancing the brightness of the design.

Because the stones are placed closely together, the metal becomes less visible, allowing the diamonds to dominate the visual texture.

Lab Grown Diamond Characteristics

Lab grown diamonds possess the same physical and optical characteristics as mined diamonds. They are produced in controlled environments rather than extracted from the earth.

These diamonds are created without traditional mining, though environmental impact can vary depending on production methods and energy sources.

A Bracelet Designed for Everyday Elegance

Diamond bracelets featuring symbolic motifs are often chosen for their versatility and meaningful design elements. The combination of pavé diamonds and the heart motif creates a bracelet that balances subtle sparkle with expressive styling.

The design allows the bracelet to complement a wide range of looks while maintaining a delicate and refined presence.

Product Information
SKU SHP-BRACELET052310018
Length 177.8 mm
Width 10 mm
Height 1.5 mm
Metal Weight 4.26 gm (Approximate)
Total Stone Weight 0.86 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 135 Pieces
Total Weight 0.86 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-24 Pcs
Round-1.10X1.10 mm-111 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade VS
View More

FAQs About: Pave Set Lab Grown Diamond Heart Bracelet for Women

What is a pavé diamond setting?
A pavé setting places small diamonds closely together on the surface of a piece of jewelry to create a continuous sparkling appearance.
What does a heart bracelet symbolize?
Heart-shaped jewelry is commonly associated with affection, emotional connection, and meaningful gestures.
Are lab grown diamonds real diamonds?
Lab grown diamonds have the same physical and optical properties as natural diamonds but are produced in controlled laboratory environments.
Why are pavé diamonds used in jewelry?
Pavé diamonds create a continuous surface of sparkle that enhances the brilliance of the jewelry design.
Can diamond bracelets be worn daily?
Many diamond bracelets are designed for regular wear because their compact gemstone settings help protect the stones while maintaining sparkle.
What occasions are heart bracelets suitable for?
Heart bracelets are often chosen for gifts that celebrate relationships, anniversaries, or meaningful milestones.