Pear Shape Diamond Solitaire Earring for Helix Piercing

Sale price £333.00 Regular price £382.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Refined yet expressive, this pear shape diamond solitaire earring brings a soft teardrop sparkle to curated ear styling. A single pear shaped diamond is secured in a 3 prong setting, giving the design a graceful point and rounded glow that feels delicate without disappearing. Made for helix, cartilage, conch, or upper lobe piercings, it is a thoughtful choice for birthdays, anniversaries, or simply marking a personal style moment with a piece that feels quietly special.

Solitaire Earring for Helix Piercing with Pear Shape Diamond

This helix earring highlights one pear shaped diamond measuring approximately 3X5 mm with an approximate total weight of 0.18 carat. The diamond is brilliant cut, HI color, SI quality grade, and prong set on a unique motif. Available in 10K, 14K, and 18K yellow or white gold, with selectable flat back post lengths and left or right ear options, it is designed for a personalized fit in a modern piercing stack.

What Makes This Special

The design centers on a single pear shaped diamond, allowing the silhouette to feel clean, focused, and easy to style with other earrings.

The 3 prong setting holds the diamond securely while keeping the teardrop shape visible, so the stone’s pointed tip and rounded base remain the visual focus.

With an approximate stone weight of 0.18 carat and an approximate metal weight of 0.70 gm, the earring offers noticeable sparkle in a compact format suited to helix and cartilage placement.

Why Choose This Design

A pear shape diamond brings the softness of a rounded stone together with the direction and length of a pointed silhouette. This makes the earring flattering for cartilage styling, where a compact shape with visible movement can make a strong impression.

The solitaire layout keeps the look refined and versatile, while the prong setting allows light to reach the diamond for a bright, polished effect. Flat back post length options help the earring sit neatly in the chosen piercing, making it easier to build a comfortable and balanced ear stack.

Design Meaning

The pear shape is often loved for its teardrop-inspired form, making it a meaningful choice for emotion, individuality, and graceful strength. In a solitaire design, the single diamond becomes the focus, symbolizing one clear intention or personal milestone. Whether chosen as a gift or as a signature piercing piece, it carries a sense of quiet confidence and personal meaning.

Authenticity & Craftsmanship

This earring is crafted with careful attention to stone alignment, prong security, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to your purchase. Before dispatch, each piece goes through stone inspection, setting security review, and finishing inspection. For care, keep it away from harsh chemicals, perfumes, and chlorine, store it separately, and wipe gently with a soft cloth after wear.

Style and Wearability

This single pear diamond earring can be worn as a delicate focal point in a helix piercing or styled with tiny studs and hoops for a layered cartilage look. Yellow gold gives the diamond a warm contrast, while white gold creates a crisp, luminous finish. The left and right ear options make it easier to position the pear silhouette naturally, whether worn alone or as part of an asymmetric ear stack.

Product Information
SKU SHP-BODYJ082410076
Metal Weight 0.70 gm (Approximate)
Total Stone Weight 0.18 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-1 Pcs
Color HI
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Pear Shape Diamond Solitaire Earring for Helix Piercing

What stone is used in the Pear Shape Diamond Solitaire Earring for Helix Piercing?

This earring features one pear shaped diamond with an approximate total weight of 0.18 carat. The diamond measures approximately 3X5 mm, has HI color, SI quality grade, and a brilliant cut.

What setting style is used for the diamond?

The pear shaped diamond is secured in a prong setting. This setting supports the stone while keeping the pear silhouette visible and allowing the diamond to remain the center of the design.

Can this earring be worn in piercings other than the helix?

Yes. This solitaire earring can be worn on helix, cartilage, conch, or upper lobe piercings, depending on the wearer’s piercing placement and preferred fit.

Is this earring sold as a single piece or a pair?

This earring is sold singly, making it suitable for one-ear styling, asymmetric piercing looks, or pairing with other cartilage earrings and studs.

What metal options are available for this pear diamond helix earring?

This earring is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold.

Does this earring come with flat back post length options?

Yes. Flat back post length options include 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm, so the wearer can choose a fit suited to the piercing.

How should I care for this diamond solitaire helix earring?

Avoid harsh chemicals, perfumes, chlorine, and abrasive cleaners. Store the earring separately and wipe it gently with a soft cloth after wear to help protect the diamond and metal finish.