Pear Shaped Black Onyx Necklace and Earrings Set with Moissanite

Sale price £967.00 Regular price £1,087.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Designed to bring elegance and depth to your bridal look, this Black Onyx Jewelry Set captures sophistication in every detail. Thoughtfully crafted with precision, the Black and White Jewelry Set includes a pendant necklace and matching stud earrings. The necklace showcases a stunning 8X10 MM pear shaped black onyx at the center, secured in prong setting. Enhancing the centerpiece are sparkling round moissanite stones arranged along a graceful leaf motif, giving the design a natural yet stylish appeal. Suspended from a standard bail, the Leaf Necklace rests perfectly on a durable cable chain, sitting elegantly on the neckline. Complementing the necklace are matching leaf shaped stud earrings, each adorned with delicate moissanite stones and a 3X5 MM black onyx that enhances their dark beauty. The earrings feature screw-back closures, ensuring comfort and security for all-day wear. The combination of AAA quality black onyx and D-VS1 quality moissanite offers a striking contrast, the deep black tones paired with bright sparkle create a captivating effect that stands out effortlessly. Whether worn together for a coordinated look or separately for subtle elegance, this Black Onyx Necklace and Earrings adds charm and sophistication to any special occasion.

Product Information
SKU SHP-PENDANT042159962
Length 24 mm
Width 9 mm
Metal Weight 4.44 gm (Approximate)
Total Stone Weight 2.89 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 3 Pieces
Total Weight 2.56 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-2 Pcs
Pear-8X10 mm-1 Pcs
Color Black
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
MOISSANITE INFORMATION
No.of Stones 54 Pieces
Total Weight 0.33 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-12 Pcs
Round-0.90X0.90 mm-24 Pcs
Round-1.10X1.10 mm-5 Pcs
Round-1.20X1.20 mm-9 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1X1 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
black-onyx-necklaces