Real Black Onyx Leaf Wedding Band for Women

Sale price £799.00 Regular price £897.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

The real black onyx leaf wedding band offers a distinctive alternative to traditional wedding styles. With its nature-inspired leaf detailing and bold black onyx accents, this band is designed for women who appreciate contrast, individuality, and refined symbolism in their jewelry.

Leaf-Inspired Design & Setting

The leaf motif introduces organic movement and texture along the band, creating a graceful silhouette that feels both elegant and expressive. Black onyx provides deep, dramatic contrast against the metal, highlighting the intricate design. The structured placement of the stones enhances visual balance while maintaining a comfortable band profile.

Black Onyx & Wearability

Black onyx is valued for its rich, opaque color and smooth finish. When securely set and worn with care, it can be suitable for regular wear. Its bold tone makes it an appealing choice for those seeking a wedding band that stands apart from classic all-diamond styles.

Key Highlights

  • Nature-inspired leaf motif: organic detailing with symbolic meaning.
  • Real black onyx accents: striking contrast and depth.
  • Distinctive aesthetic: ideal for non-traditional wedding styling.
  • Versatile pairing: complements solitaire or gemstone engagement rings.
Product Information
SKU SHP-RINGS052182256
Width 1.3 mm
Height 5.5 mm
Metal Weight 3.30 gm (Approximate)
Total Stone Weight 6.24 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 80 Pieces
Total Weight 6.24 Carat (Approximate)
Dimension(approx) Round-2X2 mm-80 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
black-onyx-rings

Real Black Onyx Leaf Wedding Band for Women

Is black onyx suitable for a wedding band?
Black onyx can be worn in wedding bands when set securely. It benefits from mindful care to maintain its smooth surface and finish.
What does a leaf design symbolize?
Leaf motifs often represent growth, renewal, and natural beauty, making them meaningful elements in wedding jewelry.
Can this band be paired with an engagement ring?
Yes, it can be paired with solitaire or gemstone engagement rings. The fit will depend on the engagement ring’s profile and setting style.
Is this style considered traditional?
The leaf detailing and black onyx create a more contemporary, nature-inspired look compared to classic plain metal or diamond bands.
Is the band suitable for everyday wear?
When properly fitted and worn with care, this band can be suitable for daily wear. Periodic checks help maintain its condition.