Real Blue Sapphire Flower Engagement Ring with Diamond

Sale price £1,178.00 Regular price £1,294.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bloom into a beautiful love story with this enchanting Flower Engagement Ring, thoughtfully designed to celebrate romance, devotion and lifelong togetherness. At the center of the Flower motif rests a sparkling 4 mm Round Shaped Blue Sapphire set in Prong Setting, admired for symbolizing loyalty, sincerity and lasting commitment. Surrounding the vibrant AAA Quality Blue Sapphire are dainty HI-SI Quality Diamond stones that add a soft shimmer, creating a design inspired by the beauty of a blooming flower in full grace. The floral pattern represents growth, new beginnings and a relationship that continues to flourish with time, making this Blue Sapphire Engagement Ring far more meaningful than an ordinary piece of jewelry. Perfect as an engagement ring, promise ring, anniversary gift or a heartfelt surprise for someone special, this Blue Sapphire Diamond Ring captures emotions that words often cannot express. The elegant combination of deep Blue Sapphire and shimmering Diamond stones creates a romantic charm that suits both modern and timeless styles. Available in various ring sizes for the perfect fit, this Nature Inspired Engagement Ring arrives in a signature jewelry box, ready to make any occasion unforgettable. Whether gifted as a symbol of eternal love or cherished as a precious memory, this Blue Sapphire Ring for Women beautifully reflects a bond meant to grow stronger with every passing moment.

Product Information
SKU SHP-RINGS122041624
Width 6.8 mm
Height 9 mm
Metal Weight 3.26 gm (Approximate)
Total Stone Weight 0.83 Carat (Approximate)
BLUE SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.40 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 50 Pieces
Total Weight 0.43 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-8 Pcs
Round-0.90X0.90 mm-8 Pcs
Round-1.10X1.10 mm-8 Pcs
Round-1.20X1.20 mm-8 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1.50X1.50 mm-2 Pcs
Round-1X1 mm-8 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
blue-sapphire-engagement-rings