Real Freshwater Pearl and Diamond Bridal Stud Earrings

Regular price £1,296.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Stunning and exuding a classic charm, these Freshwater Pearl Stud Earrings feature an elegant and adaptable design, creating a unique and striking accessory. They are embellished with a 7 MM Round freshwater pearl set in bead setting, accompanied by round cut diamonds arranged in prong setting within an open circle motif. This seemingly simple yet elegant piece boasts a captivating design that remains timeless. Fastened with a screw back closure, these Open Circle Earrings showcase their brilliant sparkle. This beautiful pair of earrings adds a touch of femininity and delicacy to your ensemble. With their gorgeous appearance, these Eternity Stud Earrings create a dramatic impact, enhancing your outfits as well. Perfect for brides on their wedding day or for any special occasion, these earrings are synonymous with royalty and luxury. The combination of AAA quality Freshwater Pearls and HI-SI quality Diamonds gives these Wedding Earrings a regal touch, making them an ideal choice to elevate your look. The epitome of sophistication, these Pearl and Diamond Earrings blend versatility and elegance, making a stunning statement.

Product Information
SKU SHP-EARRINGS1019634
Length 16 mm
Width 14.3 mm
Height 7.5 mm
Metal Weight 2.53 gm (Approximate)
Total Stone Weight 7.15 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 2 Pieces
Total Weight 6.00 Carat (Approximate)
Dimension(approx) Round-7X7 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 26 Pieces
Total Weight 1.15 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-12 Pcs
Round-2.20X2.20 mm-14 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
freshwater-pearl-earrings