Real Garnet 2 Stone Infinity Promise Ring with Diamond

Sale price £632.00 Regular price £709.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Intertwined in elegance and emotion, this Toi Et Moi Ring beautifully symbolizes a love that flows endlessly. Two Pear Shape Garnet stones of size 3X5 mm rest side by side, placed horizontally to create a striking infinity design that represents unity, connection and a bond that only grows stronger with time. Their romantic red hue speaks of passion and devotion, while the dainty Diamond stones add a delicate sparkle. Every detail feels meaningful, from the curves of the infinity motif to the gentle shimmer of the stones, making this Garnet Promise Ring a heartfelt expression of commitment. Thoughtfully crafted and available in various ring sizes, this Garnet Diamond Ring offers a comfortable fit meant to be worn and cherished every day. Presented in a signature jewelry box, this Infinity Promise Ring arrives ready to turn a simple moment into something truly unforgettable. Romantic, elegant and deeply symbolic, this Moi Et Toi Ring is a beautiful reminder that when two hearts come together, their story becomes limitless.

Product Information
SKU SHP-RINGS032221869
Metal Weight 1.76 gm (Approximate)
Total Stone Weight 0.73 Carat (Approximate)
GARNET INFORMATION
No.of Stones 2 Pieces
Total Weight 0.60 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-2 Pcs
Color Red
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 0.13 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-2 Pcs
Round-1.40X1.40 mm-4 Pcs
Round-1.50X1.50 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
garnet-rings