Real Garnet and Diamond Infinity Heart Jewelry Set

Regular price £2,293.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Designed to capture emotion and timeless elegance, this Garnet and Diamond Jewelry Set is a meaningful expression of love and devotion. Each piece in the set is adorned with a striking 8MM heart shaped garnet. Surrounding the garnet, a halo of sparkling diamonds adds brilliance, enhancing the beauty of the centerpiece while creating a luxurious finish. The pendant is further elevated by a graceful infinity symbol at the top, delicately studded with diamonds. This iconic motif represents eternity and unbreakable bonds, adding powerful symbolism to the design. The matching heart stud earrings mirror the same elegant detailing and are finished with secure screw back closures, ensuring comfort and confidence for everyday wear or special occasions. Perfect for anniversaries, weddings, Valentine’s Day, or heartfelt gifting, this Heart Necklace and Earrings blend classic romance with sophisticated craftsmanship. Its cohesive design allows the pieces to be worn together for a statement look or individually for understated elegance. Thoughtfully crafted to stand the test of time, this Heart Infinity Necklace Set is a lasting keepsake destined to be treasured for generations.

Product Information
SKU SHP-PENDANT042160079
Metal Weight 6.90 gm (Approximate)
Total Stone Weight 12.75 Carat (Approximate)
GARNET INFORMATION
No.of Stones 3 Pieces
Total Weight 12.00 Carat (Approximate)
Dimension(approx) Heart-8X8 mm-3 Pcs
Color Red
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 92 Pieces
Total Weight 0.75 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-9 Pcs
Round-1.10X1.10 mm-54 Pcs
Round-1X1 mm-29 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
january-birthstone-jewelry