Real Tanzanite Rose Flower Engagement Ring with Diamond Bypass Shank

Sale price £856.00 Regular price £962.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Romantic Floral Engagement Design

The Real Tanzanite Rose Flower Engagement Ring with Diamond Bypass Shank is created for those who want their proposal to feel personal and distinctive. The rose-inspired center design reflects romance and symbolism, while the natural tanzanite adds a rich, expressive hue that stands apart from traditional engagement styles. This ring is suited for someone who values artistry and individuality in fine jewelry.

Rose Motif with Bypass Shank Structure

The rose flower setting frames the center stone in a sculpted form that adds dimension and visual depth. A bypass shank design gently curves around the centerpiece, enhancing movement and creating a balanced silhouette on the finger. Diamond accents further highlight the design, adding controlled brilliance without overwhelming the central gemstone. Detailed specifications regarding stone size, metal options, and construction are listed in the product tables above.

Natural Tanzanite & Diamond Combination

This ring features real tanzanite as the center stone, paired with diamond accents for contrast and added sparkle. Tanzanite is appreciated for its distinctive blue-violet tones and unique presence in engagement jewelry. As with many colored gemstones, mindful wear and regular care are recommended to help preserve its appearance over time. Complete gemstone and grading details are available in the product information tables above.

High-Level Features

  • Floral rose-inspired center design for a romantic aesthetic.
  • Bypass shank structure for graceful finger coverage and visual flow.
  • Natural tanzanite centerpiece complemented by diamond accents.
  • Metal options and full technical specifications provided above for transparency.
Product Information
SKU SHP-RINGS0821192920
Width 5 mm
Height 11.5 mm
Metal Weight 3.22 gm (Approximate)
Center Stone Weight 0.54 Carat (Approximate)
TANZANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.54 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-14 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.40X1.40 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
tanzanite-rings
Is the tanzanite in this ring natural?
Yes, this ring features real tanzanite. Specific stone details are provided in the product specification tables above.
Is tanzanite suitable for an engagement ring?
Tanzanite is chosen for its distinctive color and elegance. As a colored gemstone, it benefits from mindful wear and regular care to help maintain its appearance.
What does a bypass shank mean?
A bypass shank features two ends of the band that curve toward the center stone without fully meeting, creating a flowing and elegant visual effect.
Are the side stones genuine diamonds?
Yes, this design includes diamond accents. Detailed information about the diamonds can be found in the product tables above.
Can this ring be resized?
Resizing availability depends on the selected metal and design structure. Please review the store’s sizing and policy information for guidance.