Round Blue Sapphire and Diamond Half Eternity Ring

Sale price £709.00 Regular price £779.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Round Blue Sapphire and Diamond Half Eternity Ring

This half eternity ring combines round blue sapphires with diamonds in a refined alternating pattern. The deep blue gemstones introduce striking color while the diamonds contribute light reflection and brilliance. Together, they create a balanced design suited for everyday elegance or meaningful occasions.

Half eternity rings are valued for their graceful appearance, offering continuous gemstones across the visible portion of the band while maintaining comfort for daily wear.

Half Eternity Band Design

A half eternity ring features gemstones set across the top half of the band. This design highlights the stones that remain visible on the finger while keeping the underside of the band smooth and comfortable.

The style allows for a visually continuous row of gemstones while maintaining practicality for regular wear, making it a popular choice for wedding bands and anniversary rings.

Alternating Gemstone Setting

Alternating gemstones introduce visual rhythm to the ring design. In this style, blue sapphires and diamonds are arranged sequentially to create contrast between deep color and bright sparkle.

This setting approach emphasizes each gemstone individually while maintaining a cohesive overall look across the band.

Blue Sapphire Characteristics

Blue sapphire is known for its rich color and enduring popularity in fine jewelry. The gemstone’s deep blue tone provides a sophisticated contrast when paired with diamonds.

Sapphires are often selected for rings because their durability makes them suitable for jewelry worn regularly.

Diamond Accent Details

Diamonds are used in jewelry designs for their ability to reflect light and enhance surrounding gemstones. In this ring, diamond accents complement the blue sapphires by adding brightness and sparkle.

The pairing of diamonds with colored gemstones creates a classic aesthetic that has long been favored in wedding and anniversary jewelry.

Product Information
SKU SHP-RINGS052015212
Width 2.8 mm
Height 3 mm
Metal Weight 2.20 gm (Approximate)
Total Stone Weight 0.80 Carat (Approximate)
BLUE SAPPHIRE INFORMATION
No.of Stones 5 Pieces
Total Weight 0.60 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-5 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.20 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-8 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
eternity-rings

FAQs About: Round Blue Sapphire and Diamond Half Eternity Ring

What is a half eternity ring?
A half eternity ring features gemstones set across the upper half of the band, allowing the stones to remain visible while the underside stays smooth for comfort.
Why combine blue sapphires with diamonds in a ring?
Blue sapphires provide deep color while diamonds add brightness and sparkle, creating a balanced contrast that enhances the overall design.
Can a half eternity ring be worn daily?
Half eternity rings are commonly designed for everyday wear because the stones are placed on the top portion of the band while the underside remains smooth.
Is this style suitable as a wedding or anniversary ring?
Half eternity rings are often chosen as wedding bands, anniversary rings, or stacking rings because their gemstone pattern creates a refined and symbolic design.
What does alternating gemstone design mean?
An alternating gemstone design places different stones in sequence along the band, allowing each gemstone type to stand out while forming a cohesive pattern.
Can this ring be paired with other rings?
Half eternity bands are often paired with engagement rings or worn in stacks because their gemstone layout complements many ring styles.